| PDBID: | 8wv2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-22 | | Sequence: | >Entity 1
MLTDNWKELAGKAQSTFQKSLKQAIELADFDEGLAKRYGALPSAIGANVEDFGSPAQFPLEEYLKALPKKVLDITEKDPVELLKDLKSRKVTCVEVLKAYTAASIVASKLTNCVQEFLPIEALQYAQKLDADYETKKHLPLYGLPFSIKEMIPFVGRSVTHGSLCYLDRIVDYNADIVNILIANGAYPFVRTTNPQSLMMLECVSFSHGRTVNAYNGMLTSGGSSGGEGALNGMRASPFGLGSDIGGSIRCPAAFNGIYGLRSTLGRIPTADYFSCNRGSESILSVTGPLSRSLDTVNLVMKTVIEAKPWLIDPTLVPLDWKRPENKKFRVGIYVSDHIVNPSPPINRALSMVTEKLKSLGNFEVVTFEPYKPEKVTEILGKLYFEDGARDFRATLQTGEPLLEQTRWAIEGAEDLDMHDQWYWNLQKQAYRKEFLKHWCSYTDNDGNVLDAVIAPVFPNVAAKHETTKYWTYTSQWNLLDYPVLAFPVTKVDESLDQPYKNYKPLNDLDKYFYEQYDSPSSFKNAPANLCLVGLRFTDEKLVEIANILRN
|
|
| PDBID: | 8qx3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-21 |
|
| PDBID: | 8up5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-21 | | Release date: | 2025-04-20 |
|
| PDBID: | 8wur | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of SARS-Cov-2 main protease D48N mutant in complex with shikonin | | Authors: | Zhao, Z.Y., Li, W.W., Zhang, J., Li, J. | | Deposition date: | 2023-10-21 | | Release date: | 2024-10-21 |
|
| PDBID: | 8qx1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8up2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8up0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8uov | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8uot | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8uom | | Status: | HPUB -- hold until publication | | Title: | LSD1-CoREST with N-formyl-FAD in complex with H3dimeK4 histone tail | | Authors: | Caroli, J., Mattevi, A. | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8uon | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8up4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8uoq | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8wu9 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human canonical nucleosome | | Authors: | Liu, X., Gong, Q.Y. | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8wub | | Status: | HPUB -- hold until publication | | Title: | The X-ray structure of human neuroglobin C120S mutant | | Authors: | Lin, Y.W., Yuan, H. | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8wuj | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of A. thaliana H2A.W nucleosome | | Authors: | Liu, X., Gong, Q.Y. | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8wuh | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of A. thaliana canonical H2A.13 nucleosome | | Authors: | Liu, X., Gong, Q.Y. | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8qwf | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-19 |
|
| PDBID: | 8qw9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-19 |
|
| PDBID: | 8qwe | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-19 |
|
| PDBID: | 8qwd | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-19 |
|
| PDBID: | 8qwc | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-19 |
|
| PDBID: | 8qwj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of GFP variant | | Authors: | Lenz, M., Fiedler, M., Bellini, D., Chin, J.W. | | Deposition date: | 2023-10-19 |
|
| PDBID: | 8qw8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-19 |
|
| PDBID: | 8uoh | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human NUAK1-MARK3 kinase domain chimera bound with small molecule inhibitor #10 | | Authors: | Delker, S.L., Abendroth, J. | | Deposition date: | 2023-10-19 |
|
