| PDBID: | 9g1s | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 | | Sequence: | >Entity 1
MLSGLNHLTLAVSQLAPSVAFYQQLLGMTLHARWDSGAYLSCGDLWLCLSLDPQRRVTPPEESDYTHYAFSISEADFASFAARLEAAGVAVWKLNRSEGASHYFLDPDGHKLELHVGSLAQRLAACREQPYKGMVFFEQHHHHHH
|
|
| PDBID: | 9g2d | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9g2e | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9g25 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9g28 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9g1w | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9g1u | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9g1x | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9ipc | | Status: | AUCO -- author corrections pending review | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9ipd | | Status: | AUCO -- author corrections pending review | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9ipe | | Status: | AUCO -- author corrections pending review | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9ip8 | | Status: | AUCO -- author corrections pending review | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9ip9 | | Status: | AUCO -- author corrections pending review | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9ipa | | Status: | AUCO -- author corrections pending review | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9ipb | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9ip7 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9ip6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9ip0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9ioy | | Status: | HPUB -- hold until publication | | Title: | Isophthalate dioxygenase in complex with isophthalate | | Authors: | Jangid, K., Mahto, J.K., Kumar, P. | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9ip2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the RNA-dependent RNA polymerase complex from Marburg virus | | Authors: | Li, G., Du, T., Wang, J., Wu, S., Ru, H. | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9ip4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the RNA-dependent RNA polymerase complex from Marburg virus | | Authors: | Li, G., Du, T., Wang, J., Wu, S., Ru, H. | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9ip3 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the RNA-dependent RNA polymerase complex in a compact conformation from Ebola virus | | Authors: | Li, G., Du, T., Wang, J., Wu, S., Ru, H. | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9ipf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9ipg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 |
|
| PDBID: | 9ipk | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-10 | | Release date: | 2025-07-10 |
|
