| PDBID: | 9ekp | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of WDR55 in complex with XS381774 | | Authors: | Chen, U.H., Li, F., Zeng, H., Ahmad, H., Wang, X., Sun, J., Dong, A., Seitova, A., Arrowsmith, C.H., Edwards, A.M., Peng, H., Halabelian, L., Structural Genomics Consortium (SGC) | | Deposition date: | 2024-12-03 | | Sequence: | >Entity 1
SMEAPTRIRDTPEDIVLEAPASGLAFHPARDLLAAGDVDGDVFVFSYSCQEGETKELWSSGHHLKACRAVAFSEDGQKLITVSKDKAIHVLDVEQGQLERRVSKAHGAPINSLLLVDENVLATGDDTGGIRLWDQRKEGPLMDMRQHEEYIADMALDPAKKLLLTASGDGCLGIFNIKRRRFELLSEPQSGDLTSVTLMKWGKKVACGSSEGTIYLFNWNGFGATSDRFALRAESIDCMVPVTESLLCTGSTDGVIRAVNILPNRVVGSVGQHTGEPVEELALSHCGRFLASSGHDQRLKFWDMAQLRAVVVDD
|
|
| PDBID: | 9el2 | | Status: | HPUB -- hold until publication | | Title: | Human Hsp27 alpha-crystallin domain (84-171) T151I in complex with a peptide mimic of its C-terminus | | Authors: | Benesch, J.L.P., Allison, T.M., Gastall, H., Laganowsky, A. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9el3 | | Status: | HPUB -- hold until publication | | Title: | Human Hsp27 alpha-crystallin domain (84-171) T164A in complex with a peptide mimic of its C-terminus | | Authors: | Benesch, J.L.P., Allison, T.M., Gastall, H., Laganowsky, A. | | Deposition date: | 2024-12-03 |
|
| PDBID: | 9hk2 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9hjy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9hjx | | Status: | HPUB -- hold until publication | | Title: | Structure of the Thermus termophillus transhydrogenase | | Authors: | Trasnea, P.I., Sazanov, L. | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9kt8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9kt7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9kt6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9ktj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9kta | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9ktb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9ktc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9ktd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9kte | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9ktf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9ktq | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the pathogen-secreted apoplastic GH12 xyloglucan-specific endoglucanase XEG1 | | Authors: | Xia, Y.Q., Liu, L., Zhang, Q., Shi, X.C., Wang, Z.K., Zhang, Z.C., He, X.Y., Xiao, J.H., Jiang, H.B., Zhang, S.C., Yang, Y.H., Ye, W.W., Wang, Z.Y., Wang, Y., Ma, Z.C., Yang, Q., Wang, Y.C. | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9ktg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9ktp | | Status: | HPUB -- hold until publication | | Title: | Fe(II)/2-oxoglutarate-dependent dioxygenase UcsF in complexed with Ni and N-oxalylglycine (NOG) | | Authors: | Zhao, S., Nie, Y. | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9kth | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9ktn | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of SARS-CoV-2 nsp10-nsp16 methyltransferase complex with MI54 | | Authors: | Cao, L., Xu, T.F., Yan, L.M., Yang, S.D., Zhang, H.W., Ji, Y.X., Ge, J., Fan, S.L., Li, C.M., Rao, Z.H., Lou, Z.Y., Guo, D.Y. | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9kts | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9ktt | | Status: | HPUB -- hold until publication | | Title: | Structure of TauT in complex with taurine | | Authors: | Yin, Y.X., Lu, Y.S., Ding, D. | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9kt9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-02 |
|
| PDBID: | 9ekh | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-12-02 |
|
