| PDBID: | 8qh2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-06 |
|
| PDBID: | 8qgz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-06 | | Release date: | 2025-03-06 |
|
| PDBID: | 8u2g | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human LC3A soaked with RAPTA-C | | Authors: | Eade, L., Sullivan, M.P., Hartinger, C.G., Goldstone, D.C. | | Deposition date: | 2023-09-06 | | Release date: | 2025-02-28 |
|
| PDBID: | 8u2j | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human GABARAPL2 soaked with RAHQ-C [Ru(p-cymene)(N,O-8-hydroxyquinolato)Cl] | | Authors: | Eade, L., Sullivan, M.P., Hartinger, C.G., Goldstone, D.C. | | Deposition date: | 2023-09-06 | | Release date: | 2025-02-28 |
|
| PDBID: | 8u2i | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of human GABARAPL2 soaked with RAPTA-C | | Authors: | Eade, L., Sullivan, M.P., Hartinger, C.G., Goldstone, D.C. | | Deposition date: | 2023-09-06 | | Release date: | 2025-02-28 |
|
| PDBID: | 8u2k | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of human GABARAPL1 soaked with RAPTA-C | | Authors: | Eade, L., Sullivan, M.P., Hartinger, C.G., Goldstone, D.C. | | Deposition date: | 2023-09-06 | | Release date: | 2025-02-28 |
|
| PDBID: | 8u2l | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of KAI2 S95C L48I mutant | | Authors: | Davies, S.F., Waters, M.T., Bond, C.S. | | Deposition date: | 2023-09-06 | | Sequence: | >Entity 1
GVVEEAHNVKVIGSGEATIVLGHGFGTDQSVWKHLVPHLVDDYRVVIYDNMGAGTTNPDYFDFDRYSNLEGYSFDLIAILEDLKIESCIFVGH(OCS)VSAMIGVLASLNRPDLFSKIVMISASPRYVNDVDYQGGFEQEDLNQLFEAIRSNYKAWCLGFAPLAVGGDMDSIAVQEFSRTLFNMRPDIALSVGQTIFQSDMRQILPFVTVPCHILQSVKDLAVPVVVSEYLHANLGCESVVEVIPSDGHLPQLSSPDSVIPVILRHIRNDI
|
|
| PDBID: | 8u2n | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The cryo-EM structure of Pseudomonas phage vB_PaeM_C2-10_Ab1 neck (portal:H-t-T:collar:gateway) | | Authors: | Li, F., Cingolani, G. | | Deposition date: | 2023-09-06 | | Release date: | 2025-03-12 |
|
| PDBID: | 8u2h | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human LC3A soaked with RAHQ-C [Ru(p-cymene)(N,O-8-hydroxyquinlinato)Cl] | | Authors: | Eade, L., Sullivan, M.P., Hartinger, C.G., Goldstone, D.C. | | Deposition date: | 2023-09-06 | | Release date: | 2025-02-28 |
|
| PDBID: | 8qg2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 | | Release date: | 2025-03-05 |
|
| PDBID: | 8qg3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 | | Release date: | 2025-03-05 |
|
| PDBID: | 8qg4 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 | | Release date: | 2025-03-05 |
|
| PDBID: | 8qg5 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 | | Release date: | 2025-03-05 |
|
| PDBID: | 8qg6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 | | Release date: | 2025-03-05 |
|
| PDBID: | 8qg7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 | | Release date: | 2025-03-05 |
|
| PDBID: | 8qg8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 | | Release date: | 2025-03-05 |
|
| PDBID: | 8qg9 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 | | Release date: | 2025-03-05 |
|
| PDBID: | 8qga | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 | | Release date: | 2025-03-05 |
|
| PDBID: | 8qgb | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 | | Release date: | 2025-03-05 |
|
| PDBID: | 8qgc | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 | | Release date: | 2025-03-05 |
|
| PDBID: | 8qge | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 | | Release date: | 2025-03-05 |
|
| PDBID: | 8qgg | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 | | Release date: | 2025-03-05 |
|
| PDBID: | 8qgh | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 | | Release date: | 2025-03-05 |
|
| PDBID: | 8qgi | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 | | Release date: | 2025-03-05 |
|
| PDBID: | 8qgj | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | | Authors: | Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2023-09-05 | | Release date: | 2025-03-05 |
|
