| PDBID: | 9h71 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-25 |
|
| PDBID: | 9h6s | | Status: | HPUB -- hold until publication | | Title: | Structure of the V606M/W622L mutant of myosin UNC-54 | | Authors: | Arnese, R., Meinhart, A., Deszcz, L., Clausen, T. | | Deposition date: | 2024-10-25 |
|
| PDBID: | 9h6r | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of Hydrogenosomal processing peptidase (HPP), E56Q inactive mutant, from Trichomonas vaginalis co-crystallized with presequence peptide from ferredoxin oxidoreductase (PFO) - not visible in the structure model | | Authors: | Samad, A., Barinka, C., Motlova, L., Cianci, M. | | Deposition date: | 2024-10-25 |
|
| PDBID: | 9h6v | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-25 |
|
| PDBID: | 9h74 | | Status: | HPUB -- hold until publication | | Title: | Late-stage 48S Initiation Complex with eIF3 (LS48S-eIF3 IC) guided by the trans-RNA | | Authors: | Nguyen, T.T., Hashem, Y., Rocha, R.E.O., Boissier, F., Qian, S.B., Jia, L., Uematsu, S., Gu, Y., Shi, S. | | Deposition date: | 2024-10-25 |
|
| PDBID: | 9h73 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of an octameric G10-resistosome from wheat in ''back-to-back'' arrangement | | Authors: | Guo, G.H., Zhao, H., Lukoyanova, N., Selvaraj, M., Jones, J. | | Deposition date: | 2024-10-25 |
|
| PDBID: | 9h6t | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-25 |
|
| PDBID: | 9h6u | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 S protein in complex with pT1679 Fab | | Authors: | Hansen, G., Benecke, T., Vollmer, B., Gruenewald, K., Krey, T. | | Deposition date: | 2024-10-25 |
|
| PDBID: | 9h6z | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-25 |
|
| PDBID: | 9h72 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-25 |
|
| PDBID: | 9h6i | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9h6j | | Status: | HPUB -- hold until publication | | Title: | Human B4GALNT1 Apo Structure | | Authors: | Welland, J.W.J., Deane, J.E. | | Deposition date: | 2024-10-24 | | Sequence: | >Entity 1
HHHHHHHHHHGTRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGGGLPLPFQKQVRAIDLTKAFDPAELRAASATREQEFQAFLSRSQSPADQLLIAPANSPLQYPLQGVEVQPLRSILVPGLSLQAASGQEVYQVNLTASLGTWDVAGEVTGVTLTGEGQADLTLVSPGLDQLNRQLQLVTYSSRSYQTNTADTVRFSTEGHEAAFTIRIRHPPNPRLYPPGSLPQGAQYNISALVTIATKTFLRYDRLRALITSIRRFYPTVTVVIADDSDKPERVSGPYVEHYLMPFGKGWFAGRNLAVSQVTTKYVLWVDDDFVFTARTRLERLVDVLERTPLDLVGGAVREISGFATTYRQLLSVEPGAPGLGNCLRQRRGFHHELVGFPGCVVTDGVVNFFLARTDKVREVGFDPRLSRVAHLEFFLDGLGSLRVGSCSDVVVDHASKLKLPWTSRDAGAETYARYRYPGSLDESQMAKHRLLFFKHRLQCMTSQ
|
|
| PDBID: | 9h6o | | Status: | HPUB -- hold until publication | | Title: | Leishmania major ISP2 in complex with bovine alpha-chymotrypsin | | Authors: | Freitag-Pohl, S., Pohl, E. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k7t | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of designed zinc-induced homotetramer C4-Zn1-HEHE-1 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k8v | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of the Type II secretion system protein from Vibrio cholerae | | Authors: | Liu, R.H., Feng, Q.S., Zhang, K., Dai, X., Dai, J., Guo, X.R., Lin, W.F., Wang, Z.F., Fu, Y., Li, Y. | | Deposition date: | 2024-10-24 | | Release date: | 2025-10-24 |
|
| PDBID: | 9k7u | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of designed zinc-induced heterodimer Heter-Zn2-HEHE-22 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k7w | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of designed nickel-induced homotrimer C3-Ni1-HH*3-18 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k7y | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of designed zinc-induced icosahedron Cage-i53-Zn1-HEHE-14 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k7z | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of designed zinc-induced icosahedron Cage-i53-Zn1-HEHE-16 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k80 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of designed zinc-induced filament Fiber-n6-Zn1-HEHE-5 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k81 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of designed zinc-induced filament Fiber-n7-Zn1-HEHE-74 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k82 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of designed zinc-induced filament Fiber-n5-Zn1-HEHE-917 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k83 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of designed zinc-induced filament Fiber-n6-Zn1-HEHE-43 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k8o | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-24 |
|
| PDBID: | 9k7x | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of designed calcium-induced homotrimer C3-Ca1-DN*3-20 | | Authors: | Qu, Y.N., Cao, L.X. | | Deposition date: | 2024-10-24 |
|
