| PDBID: | 8yyc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8yxy | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | NADPH and 1-benzyl-4-methylpiperidin-3-one complex structure of Imine Reductase Mutant(M6) from Pochonia chlamydosporia 170 | | Authors: | Shi, M., Zheng, G. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8yy3 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-03 | | Release date: | 2025-04-03 |
|
| PDBID: | 8yy4 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-03 | | Release date: | 2025-04-03 |
|
| PDBID: | 8yy6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8yya | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Concanavalin A Complexed with 5-Fluorouracil | | Authors: | Rasheed, S., Arif, R. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8yyg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8yyh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8yyi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8yyj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8yyk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8yyf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8yy9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8yye | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of lipase CTL (Caldibacillus Thermoamylovorans) | | Authors: | Pan, S.Y., Lan, D.M., Wang, Y.H. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8yyd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8yy5 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-03 | | Release date: | 2025-04-03 |
|
| PDBID: | 8yy2 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-03 | | Release date: | 2025-04-03 |
|
| PDBID: | 8yxv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8yyb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9bad | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9b9p | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 | | Sequence: | >Entity 1
MTTVYYDQDVKTDALQGKKIAVVGYGSQGHAHAQNLKDNGYDVVIGIRPGRSFDKAKEDGFDVFPVAEAVKQADVIMVLLPDEIQGDVYKNEIEPNLEKHNALAFAHGFNIHFGVIQPPADVDVFLVAPKGPGHLVRRTFVEGSAVPSLFGIQQDASGQARNIALSYAKGIGATRAGVIETTFKEETETDLFGEQAVLCGGVSKLIQSGFETLVEAGYQPELAYFEVLHEMKLIVDLMYEGGMENVRYSISNTAEFGDYVSGPRVITPDVKENMKAVLTDIQNGNFSNRFIEDNKNGFKEFYKLREEQHGHQIEKVGRELREMMPFIKSKSIEKHHHHHH
|
|
| PDBID: | 9bae | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9b9u | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SARS CoV-2 full-length spike protein with His1271Lys substitution in the coatomer binding motif, 1RBD-up conformation | | Authors: | Singh, S., Hasan, S.S. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9ba8 | | Status: | HPUB -- hold until publication | | Title: | O-GlcNAcase (OGA) inhibitor complex for the Treatment of Alzheimer''s Disease | | Authors: | Hendle, J., Romero, R. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 9bab | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM of Hyper2 tube, ~27 nm diameter | | Authors: | Sonani, R.R., Miller, J.G., Conticello, V., Egelman, E.H. | | Deposition date: | 2024-04-03 | | Release date: | 2025-04-03 |
|
