| PDBID: | 9e66 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of mechanosensitive channel YnaI A155V mutant in conformation 2 | | Authors: | Hiotis, G., Will, N., Walz, T. | | Deposition date: | 2024-10-29 |
|
| PDBID: | 9e68 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-29 |
|
| PDBID: | 9e69 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Antibody 5E10 | | Authors: | Zhou, T., Sao-Fong Cheung, C., Kwong, P.D. | | Deposition date: | 2024-10-29 |
|
| PDBID: | 9e61 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Saccharomyces cerevisiae Pmt4 apo form | | Authors: | Du, M., Yuan, Z., Li, H. | | Deposition date: | 2024-10-29 |
|
| PDBID: | 9e6e | | Status: | HPUB -- hold until publication | | Title: | Yeast Fzf1 Zn-fingers 1-3 bound to YHB1 26 bp DNA | | Authors: | Moore, S.A., Ma, C., Xiao, W. | | Deposition date: | 2024-10-29 |
|
| PDBID: | 9h81 | | Status: | HPUB -- hold until publication | | Title: | human carbonic anhydrase I in complex with Sonepiprazole | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2024-10-28 | | Sequence: | >Entity 1
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
| PDBID: | 9h85 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-28 |
|
| PDBID: | 9h89 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-28 |
|
| PDBID: | 9h7q | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-28 |
|
| PDBID: | 9k9x | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of bicyclogermacrene synthase | | Authors: | Tian, B.X., Fan, S.L., Chen, X.L., Guo, L. | | Deposition date: | 2024-10-28 |
|
| PDBID: | 9k9y | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of bicyclogermacrene synthase with FsPP | | Authors: | Tian, B.X., Fan, S.L., Chen, X.L., Guo, L. | | Deposition date: | 2024-10-28 |
|
| PDBID: | 9ka1 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of bicyclogermacrene synthase mutant I290V/I385C/V434C/L454C/V476W/L558I | | Authors: | Tian, B.X., Fan, S.L., Chen, X.L., Guo, L. | | Deposition date: | 2024-10-28 |
|
| PDBID: | 9ka4 | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of MSA-like fold (P1) formed under the palette stratagy. | | Authors: | Zhao, Q.Y., Tao, Y.Q., Liu, C., Li, D. | | Deposition date: | 2024-10-28 |
|
| PDBID: | 9ka3 | | Status: | HPUB -- hold until publication | | Title: | The cryo-EM structure of Ac-K58D_G51DA53T a-syn fibril. | | Authors: | Zhao, Q.Y., Tao, Y.Q., Li, D., Liu, C. | | Deposition date: | 2024-10-28 |
|
| PDBID: | 9ka8 | | Status: | HPUB -- hold until publication | | Title: | Structure of the recombinant structure of the subunit of allophycocyanin (APC) and the formate dehydrogenase (FDH) | | Authors: | Duan, M.P., Zhang, T. | | Deposition date: | 2024-10-28 |
|
| PDBID: | 9ka5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-28 |
|
| PDBID: | 9ka6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-28 |
|
| PDBID: | 9ka7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-28 |
|
| PDBID: | 9kaf | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the SPS3-FBN5 complex in a 2:1 state | | Authors: | Xiao, H., Wang, Y.-W., Zhu, P., Yang, G.-F. | | Deposition date: | 2024-10-28 |
|
| PDBID: | 9kag | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the SPS3-FBN5 complex in a 2:2 state (class 4) | | Authors: | Xiao, H., Wang, Y.-W., Zhu, P., Yang, G.-F. | | Deposition date: | 2024-10-28 |
|
| PDBID: | 9kab | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of (3R)-hydroxyacyl-ACP dehydratase HadA(C105A)B mutant from Mycobacterium tuberculosis complexed with Thioacetazone | | Authors: | Shi, Y.F., Li, J. | | Deposition date: | 2024-10-28 |
|
| PDBID: | 9kaa | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of (3R)-hydroxyacyl-ACP dehydratase HadAB from Mycobacterium tuberculosis complexed with Isoxyl | | Authors: | Shi, Y.F., Li, J. | | Deposition date: | 2024-10-28 |
|
| PDBID: | 9kac | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of (3R)-hydroxyacyl-ACP dehydratase HadA(C105A)B mutant from Mycobacterium tuberculosis complexed with Isoxyl | | Authors: | Shi, Y.F., Li, J. | | Deposition date: | 2024-10-28 |
|
| PDBID: | 9ka9 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of (3R)-hydroxyacyl-ACP dehydratase HadAB from Mycobacterium tuberculosis complexed with Thioacetazone | | Authors: | Shi, Y.F., Li, J. | | Deposition date: | 2024-10-28 |
|
| PDBID: | 9kah | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Chalcone Syntase and Chalcone Isomerase-like Protein Complex from Physcomitrella patens | | Authors: | Imaizumi, R., Waki, T., Yasuda, A., Yanai, T., Takeshita, K., Sakai, N., Yamamoto, M., Nakayama, T., Yamashita, S. | | Deposition date: | 2024-10-28 |
|
