| PDBID: | 9d0c | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-06 |
|
| PDBID: | 9d0d | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-06 |
|
| PDBID: | 9d0e | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-06 |
|
| PDBID: | 9d09 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of IgG1 FC M252H at pH 5.6 | | Authors: | Reddem, E.R., Shapiro, L. | | Deposition date: | 2024-08-06 |
|
| PDBID: | 9j2d | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-06 |
|
| PDBID: | 9j2g | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Nme1Cas9 HNH domain bound to anti-CRISPR AcrIIC1Vei | | Authors: | Xiao, Y., Wang, Z. | | Deposition date: | 2024-08-06 |
|
| PDBID: | 9j20 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-08-06 | | Release date: | 2025-08-06 |
|
| PDBID: | 9gdf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9gd7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9gd5 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of apo TRIM24 PHD-BRD in C121 space group | | Authors: | Platt, M.A., Kot, E., Conway, S.J., Koekemoer, L. | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9gda | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9gdb | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9gdc | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9gdd | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9gdj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | C-Methyltransferase SgMT from Streptomyces griseoviridis | | Authors: | Weiergraeber, O.H., Haase, M., Pietruszka, J. | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9gd6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9gd8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9gd9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9gdg | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of TRIM24 PHD-BRD in complex with N-(2-(2-(2-acetamidoethoxy)ethoxy)ethyl)-3-(N-(1,3-dimethyl-2-oxo-6-(3-propoxyphenoxy)-2,3-dihydro-1H-benzo[d]imidazol-5-yl)sulfamoyl)benzamide (PEG linker unresolved) | | Authors: | Platt, M.A., Kot, E., Conway, S.J., Koekemoer, L. | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9gdi | | Status: | HPUB -- hold until publication | | Title: | HUMAN PI3KDELTA IN COMPLEX WITH ISOCUMARIN INHIBITOR 10 | | Authors: | Pala, D., Bruno, P., Capelli, A.M., Biagetti, M. | | Deposition date: | 2024-08-05 | | Sequence: | >Entity 1
MPPGVDCPMEFWTKEENQSVVVDFLLPTGVYLNFPVSRNANLSTIKQLLWHRAQYEPLFHMLSGPEAYVFTCINQTAEQQELEDEQRRLCDVQPFLPVLRLVAREGDRVKKLINSQISLLIGKGLHEFDSLCDPEVNDFRAKMCQFCEEAAARRQQLGWEAWLQYSFPLQLEPSAQTWGPGTLRLPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYTLQVNGRHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPRAKPPPIPAKKPSSVSLWSLEQPFRIELIQGSKVNADERMKLVVQAGLFHGNEMLCKTVSSSEVSVCSEPVWKQRLEFDINICDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAWANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPTGTVRSNPNTDSAAALLICLPEVAPHPVYYPALEKILELGRHSECVHVTEEEQLQLREILERRGSGELYEHEKDLVWKLRHEVQEHFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDCHVGSFAIKSLRKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRKIGHFLFWHLRSEMHVPSVALRFGLILEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKLSSQKTPKPQTKELMHLCMRQEAYLEALSHLQSPLDPSTLLAEVCVEQCTFMDSKMKPLWIMYSNEEAGSGGSVGIIFKNGDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLPTGDRTGLIEVVLRSDTIANIQLNKSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIMIRESGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYCERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFNEALRESWKTKVNWLAHNVSKDNRQ
>Entity 2
YQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEDYTRTSQEIQMKRTAIEAFNETIKIFEEQCQTQERYSKEYIEKFKREGNETEIQRIMHNYEKLKSRISEIVDSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGN
|
|
| PDBID: | 9gde | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9gdh | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9j1w | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9j1m | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-08-05 |
|
| PDBID: | 9j1q | | Status: | HPUB -- hold until publication | | Title: | Structure of a mutant (PaDa-I) unspecific peroxygenase from Agrocybe aegerita | | Authors: | Liu, W., Zhang, J., Zhang, W. | | Deposition date: | 2024-08-05 |
|
