Loading
PDBj
MenuPDBj@FacebookPDBj@TwitterPDBj@YouTubewwPDB FoundationwwPDB
RCSB PDBPDBeBMRBAdv. SearchSearch help
Status search: 12798 results
PDBID:8tez
Status:HPUB -- hold until publication
Title:Crystal Structure of Pyridoxal Reductase (PDXI)in complex with NADPH
Authors:Donkor, A.K., Safo, M.K., Musayev, F.N.
Deposition date:2023-07-07
Release date:2024-08-01
PDBID:8tf1
Status:HPUB -- hold until publication
Title:Crystal Structure of Pyridoxal Reductase (PDXI)in complex with NADPH and Pyridoxal
Authors:Donkor, A.K., Safo, M.K., Musayev, F.N.
Deposition date:2023-07-07
Release date:2024-08-01
PDBID:8tf6
Status:HPUB -- hold until publication
Title:X-ray Crystal Structure Determination of Dihydromethanopterin Reductase A (DmrA) from Methylobacterium extorquens AM1 by Se-SAD Phasing in a F222 Crystal form at 2.70 Angstroms Resolution
Authors:Axelrod, H.L., Rasche, M., Cascio, D., Arbing, M., Collazo, M.J., Potla, P.S., ?
Deposition date:2023-07-07
Release date:2025-01-08
Sequence:

>Entity 1


(MSE)IDVRCICAIGQRGQLGLNGHLPWEGNTDPLFVEDVTRFFALT(MSE)GHVLIAGPKTVASVPEFAFKDRTIDVIRSHEDPEAVLKRYPGRRIFVGGGIAVWNVYAKYIQHWDVTRLPYDGEADRWFDPAWLVGGPLRHHHHHH
PDBID:8jzq
Status:HPUB -- hold until publication
Deposition date:2023-07-06
Release date:2025-01-06
PDBID:8jzp
Status:HOLD -- hold until a certain date
Title:Structure of mouse C5a-human C5aR1-Go complex
Authors:Yadav, M.K., Yadav, R., Maharana, J., Sarma, P., Banerjee, R., Shukla, A.K., Gati, C.
Deposition date:2023-07-06
Release date:2025-01-06
PDBID:8jzt
Status:AUTH -- processed, waiting for author review and approval
Title:The sigF and anti-sigma factor complex
Authors:Chen, Y.J., Su, D.
Deposition date:2023-07-06
Release date:2024-10-06
PDBID:8pox
Status:WAIT -- processing started, waiting for author input to continue processing
Title:Crystal Structure of the C19G variant of the membrane-bound [NiFe]-Hydrogenase from Cupriavidus necator in the H2-reduced state at 1.6 A Resolution.
Authors:Kalms, J., Schmidt, A., Scheerer, P.
Deposition date:2023-07-05
PDBID:8poy
Status:WAIT -- processing started, waiting for author input to continue processing
Title:Crystal Structure of the C120G variant of the membrane-bound [NiFe]-Hydrogenase from Cupriavidus necator in the air-oxidized state at 1.93 A Resolution.
Authors:Schmidt, A., Kalms, J., Scheerer, P.
Deposition date:2023-07-05
PDBID:8poz
Status:WAIT -- processing started, waiting for author input to continue processing
Title:Crystal Structure of the C120G variant of the membrane-bound [NiFe]-Hydrogenase from Cupriavidus necator in the H2-reduced state at 1.65 A Resolution.
Authors:Schmidt, A., Kalms, J., Scheerer, P.
Deposition date:2023-07-05
PDBID:8te8
Status:HPUB -- hold until publication
Title:Crystal Structure of Pyridoxal Reductase (PDXI)
Authors:Donkor, A.K., Safo, M.K., Musayev, F.N.
Deposition date:2023-07-05
Release date:2024-08-01
PDBID:8jz9
Status:HOLD -- hold until a certain date
Deposition date:2023-07-04
Release date:2025-02-04
PDBID:8jxr
Status:HOLD -- hold until a certain date
Deposition date:2023-07-01
Release date:2025-01-01
PDBID:8jxs
Status:HOLD -- hold until a certain date
Deposition date:2023-07-01
Release date:2025-01-01
PDBID:8jxy
Status:AUTH -- processed, waiting for author review and approval
Title:lysozyme with in situ device
Authors:Liang, M., Wang, Q.
Deposition date:2023-07-01
Release date:2025-01-01
PDBID:8pns
Status:HPUB -- hold until publication
Title:Crystal structure of the acyl-CoA dehydrogenase PA0506 (FadE1) from Pseudomonas aeruginosa
Authors:Wang, M., Brear, P., Welch, M.
Deposition date:2023-06-30
Release date:2024-12-30
PDBID:8png
Status:AUTH -- processed, waiting for author review and approval
Title:Crystal structure of the apo acyl-CoA dehydrogenase FadE2 (PA0508) from Pseudomonas aeruginosa
Authors:Wang, M., Brear, P., Welch, M.
Deposition date:2023-06-30
Release date:2024-12-30
PDBID:8pnn
Status:AUTH -- processed, waiting for author review and approval
Title:80S yeast ribosome in complex with Bromolissoclimide
Authors:Terrosu, S., Yusupov, M.
Deposition date:2023-06-30
PDBID:8pnf
Status:HPUB -- hold until publication
Title:HRV B14 virion proteins
Authors:Gil-Cantero, D., Mata, C.P., Mateu, M.G., Caston, J.R.
Deposition date:2023-06-30
Release date:2024-12-30
PDBID:8pnb
Status:HPUB -- hold until publication
Deposition date:2023-06-30
Release date:2024-12-30
PDBID:8jx4
Status:HOLD -- hold until a certain date
Title:Structure of the catalytic domain of pseudomurein endo-isopeptidases PeiW
Authors:Guo, L.Z., Zhao, N.L., Len, H., Wang, S.X., Cha, G.H., Bai, L.p., Bao, R.
Deposition date:2023-06-30
Release date:2024-09-30
PDBID:8tcb
Status:HPUB -- hold until publication
Deposition date:2023-06-30
Release date:2024-12-30
PDBID:8tbr
Status:HPUB -- hold until publication
Title:Crystal Structure of Dihydrofolate reductase (DHFR) from Mycobacterium ulcerans Agy99 in complex with NADP and inhibitor MAM758
Authors:Seattle Structural Genomics Center for Infectious Disease, Seattle Structural Genomics Center for Infectious Disease (SSGCID)
Deposition date:2023-06-29
PDBID:8jvk
Status:HPUB -- hold until publication
Deposition date:2023-06-28
Release date:2024-12-28
PDBID:8jv9
Status:HPUB -- hold until publication
Deposition date:2023-06-28
Release date:2024-12-31
PDBID:8jw1
Status:HPUB -- hold until publication
Deposition date:2023-06-28
Release date:2024-12-28

223790

PDB entries from 2024-08-14

PDB statisticsPDBj update infoContact PDBjnumon