| PDBID: | 9fdr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of human Sirt2 in apo form with opened selectivity pocket | | Authors: | Friedrich, F., Einsle, O., Jung, M. | | Deposition date: | 2024-05-17 |
|
| PDBID: | 9fdq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Single particle cryo-EM structure of the AcrB V612F monomer in the O state | | Authors: | Lazarova, M., Frangakis, A., Pos, K.M. | | Deposition date: | 2024-05-17 |
|
| PDBID: | 9fdp | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Single particle cryo-EM structure of the AcrB V612W monomer in the O state | | Authors: | Lazarova, M., Boernsen, C., Frangakis, A., Pos, K.M. | | Deposition date: | 2024-05-17 |
|
| PDBID: | 9fdo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-17 |
|
| PDBID: | 9fdn | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human phosphoglycerate kinase in complex with ATP and 3PG formed by cross-soaking a TSA crystal | | Authors: | Cliff, M.J., Waltho, J.P., Bowler, M.W., Baxter, N.J., Bisson, C., Blackburn, G.M. | | Deposition date: | 2024-05-17 |
|
| PDBID: | 9fdm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-17 |
|
| PDBID: | 9fdl | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-17 |
|
| PDBID: | 9fdk | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-17 |
|
| PDBID: | 9fdj | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-17 |
|
| PDBID: | 9fdi | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Gcase in complex with small molecule inhibitor 1 | | Authors: | Tisi, D., Cleasby, A. | | Deposition date: | 2024-05-17 |
|
| PDBID: | 9fdh | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Closed Human phosphoglycerate kinase complex with BPG and ADP produced by cross-soaking a TSA crystal | | Authors: | Cliff, M.J., Waltho, J.P., Bowler, M.W., Baxter, N.J., Bisson, C., Blackburn, G.M. | | Deposition date: | 2024-05-17 |
|
| PDBID: | 9fdg | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-17 |
|
| PDBID: | 9fdf | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fde | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fdd | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The crystal structure of full length tetramer CysB from Klebsiella aerogenes in complex with N-acetylserine | | Authors: | Verschueren, K.H.G., Dodson, E.J., Wilkinson, A.J. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fdc | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fdb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Co-crystal structure of Galectin-3 with an inhibitor | | Authors: | Mac Sweeney, A. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fda | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fd9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Re-engineered peroxygenase variant of 2-deoxy-D-ribose-5-phosphate aldolase, Schiff-base complex with 4-nitro-cinnamaldehyde | | Authors: | Thunnissen, A.M.W.H., Zhou, H., Frietema, H.O.T., Poelarends, G.J. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fd8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Re-engineered peroxygenase variant of 2-deoxy-D-ribose-5-phosphate aldolase, Schiff-base complex with 4-chloro-cinnamaldehyde | | Authors: | Thunnissen, A.M.W.H., Zhou, H., Frietema, H.O.T., Poelarends, G.J. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fd7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Re-engineered peroxygenase variant of 2-deoxy-D-ribose-5-phosphate aldolase in substrate-free state | | Authors: | Thunnissen, A.M.W.H., Zhou, H., Frietema, H.O.T., Poelarends, G.J. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fd6 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fd5 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fd4 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fd3 | | Status: | HPUB -- hold until publication | | Title: | CysG(N-16)-D190N mutant in complex with SAH from Kitasatospora cystarginea | | Authors: | Kuttenlochner, W., Beller, P., Kaysser, L., Groll, M. | | Deposition date: | 2024-05-16 | | Sequence: | >Entity 1
GSTYDALRRQLIPSFDLLYGSAVSVVAMSVPATARILDLGAGTGLLGAALRERLPDAELLLQDRSQAMLEQARQRFADDDQVAIRVADHLDELPAGPFDAVVSALSIHHLEHQDKQDLFTRIRKILRPGGIFVNVEQVLAPTSELEKMYDRQHEAHVLASDTPAEEWAAGRERMKHNIPIDVETQIQWLRDAGFTTADCLAKDWRFATYAGWNGS
|
|
