| PDBID: | 8yqh | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Cry3Aa-PEI at 3.1 A | | Authors: | Li, J., Chan, M.K. | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8yq9 | | Status: | HPUB -- hold until publication | | Title: | Quadruple mutant (N51I+C59R+S108N+I164L) Plasmodium falciparum dihydrofolate reductase-thymidylate synthase (PfDHFR-TS V1/S) complexed with FB6, NADPH and dUMP | | Authors: | Vanichtanankul, J., Vitsupakorn, D., Saeyang, T., Arwon, U., Hoarau, M., Decharuangsilp, S., Kamchonwongpaisan, S., Yuthavong, Y. | | Deposition date: | 2024-03-19 | | Sequence: | >Entity 1
MMEQVCDVFDIYAICACCKVESKNEGKKNEVFNNYTFRGLGNKGVLPWKCISLDMKYFRAVTTYVNESKYEKLKYKRCKYLNKETVDNVNDMPNSKKLQNVVVMGRTNWESIPKKFKPLSNRINVILSRTLKKEDFDEDVYIINKVEDLIVLLGKLNYYKCFILGGSVVYQEFLEKKLIKKIYFTRINSTYECDVFFPEINENEYQIISVSDVYTSNNTTLDFIIYKKTNNKMLNEQNCIKGEEKNNDMPLKNDDKDTCHMKKLTEFYKNVDKYKINYENDDDDEEEDDFVYFNFNKEKEEKNKNSIHPNDFQIYNSLKYKYHPEYQYLNIIYDIMMNGNKQSDRTGVGVLSKFGYIMKFDLSQYFPLLTTKKLFLRGIIEELLWFIRGETNGNTLLNKNVRIWEANGTREFLDNRKLFHREVNDLGPIYGFQWRHFGAEYTNMYDNYENKGVDQLKNIINLIKNDPTSRRILLCAWNVKDLDQMALPPCHILCQFYVFDGKLSCIMYQRSCDLGLGVPFNIASYSIFTHMIAQVCNLQPAQFIHVLGNAHVYNNHIDSLKIQLNRIPYPFPTLKLNPDIKNIEDFTISDFTIQNYVHHEKISMDMAA
|
|
| PDBID: | 8yq6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8yq5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8yqg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8yqk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8yql | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8yq7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8yqf | | Status: | HPUB -- hold until publication | | Title: | Structure of PsSIR2 tetradecamer | | Authors: | Yu, G., Liao, F., Li, X., Li, Z., Zhang, H. | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8yqd | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human transthyretin variant A97S in complex with Tafamidis | | Authors: | Tzeng, S.R., Huang, C.H., Wang, Y.S., Hsieh, M.F. | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8yq3 | | Status: | HPUB -- hold until publication | | Title: | Structure of cyclohexanone monooxygenase mutant from Acinetobacter calcoaceticus | | Authors: | Qiang, G., Zheng, Y.C., Feng, L., Yu, H.L. | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8yqm | | Status: | HPUB -- hold until publication | | Title: | Structure of cyclohexanone monooxygenase mutant from Acinetobacter calcoaceticus | | Authors: | Qiang, G., Zheng, Y.C., Feng, L., Yu, H.L. | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8yqj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8yqa | | Status: | HPUB -- hold until publication | | Title: | Galectin-10 L27A | | Authors: | Su, J.Y., Sun, Y.Q. | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8yqb | | Status: | HPUB -- hold until publication | | Title: | Galectin-10 N32A | | Authors: | Su, J.Y., Sun, Y.Q. | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8yqc | | Status: | HPUB -- hold until publication | | Title: | Galectin-10 C29AC57A | | Authors: | Su, J.Y., Sun, Y.Q. | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8yqe | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8yqn | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-03-19 | | Release date: | 2025-03-19 |
|
| PDBID: | 8yqo | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of human lanosterol 14alpha-demethylase (CYP51) in complex with FLZ | | Authors: | Zhou, L.C. | | Deposition date: | 2024-03-19 | | Release date: | 2025-03-19 |
|
| PDBID: | 8yqp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 8yqq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 9b3k | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 9b3e | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 9b3l | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
| PDBID: | 9b3m | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-19 |
|
