PDBID: | 9f60 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-30 |
|
PDBID: | 9f5z | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-30 |
|
PDBID: | 9f5y | Status: | WAIT -- processing started, waiting for author input to continue processing | Deposition date: | 2024-04-30 |
|
PDBID: | 9f5x | Status: | PROC -- to be processed | Deposition date: | 2024-04-30 |
|
PDBID: | 9f5w | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-30 |
|
PDBID: | 9f5v | Status: | HPUB -- hold until publication | Title: | Crystal structure of thiol peroxidase from Helicobacter pylori (HpTx, reduced) | Authors: | Fiedler, M.K., Gong, R., Fuchs, S., Rox, K., Friedrich, V., Pfeiffer, D., Reinhardt, T., Mibus, C., Huber, M., Hess, C., Mejias-Luque, R., Gerhard, M., Groll, M., Sieber, S.A. | Deposition date: | 2024-04-30 | Sequence: | >Entity 1 MASWSHPQFEKGAVTSLYKKAGFQKVTFKEETYQLEGKALKVGDKAPDVKLVNGDLQEVNLLKQGVRFQVVSALPSLTGSVCLLQAKHFNEQTGKLPSVSFSVISMDLPFSQGQICGAEGIKDLRILSDFRYKAFGENYGVLLGKGSLQGLLARSVFVLDDKGVVIYKEIVQNILEEPNYEALLKVLK
|
|
PDBID: | 9f5u | Status: | HPUB -- hold until publication | Title: | Crystal structure of Heme-Oxygenase from Corynebacterium diphtheriae complexed with Cobalt-porphyrine (HumO-Co(III)) | Authors: | Labidi, R.J., Faivre, B., Carpentier, P., Perard, J., Gotico, P., Li, Y., Atta, M., Fontecave, M. | Deposition date: | 2024-04-30 |
|
PDBID: | 9f5t | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-30 |
|
PDBID: | 9f5s | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-30 |
|
PDBID: | 9f5r | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-30 | Release date: | 2024-06-25 |
|
PDBID: | 9f5q | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-30 |
|
PDBID: | 9f5p | Status: | AUTH -- processed, waiting for author review and approval | Title: | Poliovirus type 2 (strain MEF-1) stabilised virus-like particle (PV2 SC6b) from an insect cell expression system. | Authors: | Bahar, M.W., Porta, C., Fry, E.E., Stuart, D.I. | Deposition date: | 2024-04-29 |
|
PDBID: | 9f5o | Status: | HPUB -- hold until publication | Title: | CryoEM structure of open sTeLIC in detergent, with 4-Bromoamphetamine | Authors: | Anden, O., Howard, R.J., Lindahl, E. | Deposition date: | 2024-04-29 |
|
PDBID: | 9f5n | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-29 |
|
PDBID: | 9f5m | Status: | HPUB -- hold until publication | Title: | Structure of the C-terminal domain of bacteriophage K gp155, native | Authors: | Pichel, A., van Raaij, M.J. | Deposition date: | 2024-04-29 |
|
PDBID: | 9f5l | Status: | AUTH -- processed, waiting for author review and approval | Title: | SARS-CoV-2 Nucleocapsid N-terminal domain (NTD) mutant A119S | Authors: | Dhamotharan, K., Schlundt, A. | Deposition date: | 2024-04-29 |
|
PDBID: | 9f5j | Status: | AUTH -- processed, waiting for author review and approval | Title: | SARS-CoV-2 Nucleocapsid N-terminal domain (NTD) mutant Q58I | Authors: | Dhamotharan, K., Schlundt, A. | Deposition date: | 2024-04-29 |
|
PDBID: | 9f5i | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-28 |
|
PDBID: | 9f5h | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of MGAT5 (alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase V) luminal domain with a Lys329-Ile345 loop truncation, and F445V, F504L, E297A mutations in complex with UDP and biantennary pentasaccharide M592 | Authors: | Liu, Y., Bineva-Todd, G., Meek, R., Mazo, L.M., Castillo, B.P., Moroz, O.V., Begum, N., Roustan, C., Tomita, S., Kjaer, S., Rovira, C., Davies, G.J., Schumann, B. | Deposition date: | 2024-04-28 |
|
PDBID: | 9f5b | Status: | AUTH -- processed, waiting for author review and approval | Title: | Identification of zinc ions in LMO4. | Authors: | El Omari, K., Forsyth, I., Mancini, E.J., Wagner, A. | Deposition date: | 2024-04-28 |
|
PDBID: | 9f5a | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-28 |
|
PDBID: | 9f59 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Poliovirus type 2 (strain MEF-1) stabilised virus-like particle (PV2 SC6b) from a mammalian expression system. | Authors: | Bahar, M.W., Porta, C., Fry, E.E., Stuart, D.I. | Deposition date: | 2024-04-28 |
|
PDBID: | 9f58 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-28 |
|
PDBID: | 9f57 | Status: | HPUB -- hold until publication | Title: | Identification of chloride ions in lysozyme. | Authors: | Duman, R., El Omari, K., Forsyth, I., Wagner, A. | Deposition date: | 2024-04-28 |
|
PDBID: | 9f56 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-28 |
|