| PDBID: | 9f86 | | Status: | HPUB -- hold until publication | | Title: | Human Choline O-acetyltransferase at 1.33 Angstrom resolution | | Authors: | Forsgren, N., Ekstrom, F. | | Deposition date: | 2024-05-06 |
|
| PDBID: | 9f85 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-06 |
|
| PDBID: | 9f84 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-06 |
|
| PDBID: | 9f83 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SARS-CoV-2 Nucleocapsid N-terminal domain (NTD) mutant D63G | | Authors: | Dhamotharan, K., Schlundt, A., Guenther, S. | | Deposition date: | 2024-05-06 |
|
| PDBID: | 9f82 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-06 |
|
| PDBID: | 9f81 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-06 |
|
| PDBID: | 9f80 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Rv2242 regulator C-terminal fragment (161-414) | | Authors: | Megalizzi, V., Tanina, A., Grosse, C., Mirgaux, M., Legrand, P., Dias Mirandela, G., Wohlkonig, A., Bifani, P., Wintjens, R. | | Deposition date: | 2024-05-06 |
|
| PDBID: | 9f7z | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-06 |
|
| PDBID: | 9f7y | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 papain-like protease (PLpro) C112S-K191D-Q222D-K229R-Q230R-C271S mutant | | Authors: | Camara-Artigas, A. | | Deposition date: | 2024-05-05 |
|
| PDBID: | 9f7x | | Status: | HPUB -- hold until publication | | Title: | Human PPARgamma ligand binding domain in complex with co-activator 1alpha peptide and bisphenol B (BPB) | | Authors: | Useini, A., Strater, N. | | Deposition date: | 2024-05-05 |
|
| PDBID: | 9f7w | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-05 |
|
| PDBID: | 9f7v | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | N-acetylglucosamine 6-phosphate dehydratase: GlcNAc6P substrate-bound state of NagS | | Authors: | Abrahams, J.P., Li, C. | | Deposition date: | 2024-05-05 |
|
| PDBID: | 9f7u | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 papain-like protease (PLpro) C112S-K191D-Q222D-K229R-Q230R-C271S mutant | | Authors: | Camara-Artigas, A. | | Deposition date: | 2024-05-05 |
|
| PDBID: | 9f7t | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 papain-like protease (PLpro) C112S-K191D-K229R mutant: dimer | | Authors: | Camara-Artigas, A. | | Deposition date: | 2024-05-04 |
|
| PDBID: | 9f7s | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 papain-like protease (PLpro) C112S-K191D-K229R mutant | | Authors: | Camara-Artigas, A. | | Deposition date: | 2024-05-04 |
|
| PDBID: | 9f7r | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 papain-like protease (PLpro) C112S mutant | | Authors: | Camara-Artigas, A. | | Deposition date: | 2024-05-04 |
|
| PDBID: | 9f7q | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 papain-like protease (PLpro) C112S mutant | | Authors: | Camara-Artigas, A. | | Deposition date: | 2024-05-04 |
|
| PDBID: | 9f7p | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 papain-like protease (PLpro) C112S mutant | | Authors: | Camara-Artigas, A. | | Deposition date: | 2024-05-04 |
|
| PDBID: | 9f7o | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-04 |
|
| PDBID: | 9f7n | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-04 |
|
| PDBID: | 9f7m | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-04 |
|
| PDBID: | 9f7l | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-04 |
|
| PDBID: | 9f7k | | Status: | HPUB -- hold until publication | | Title: | Glutathione transferase epsilon 1 from Drosophila melanogaster in complex with glutathione | | Authors: | Didierjean, C., Schwartz, M., Neiers, F. | | Deposition date: | 2024-05-03 | | Sequence: | >Entity 1
MSSSGIVLYGTDLSPCVRTVKLTLKVLNLDYEYKEVNLQAGEHLSEEYVKKNPQHTVPMLDDNGTFIWDSHAIAAYLVDKYAKSDELYPKDLAKRAIVNQRLFFDASVIYASIANVSRPFWINGVTEVPQEKLDAVHQGLKLLETFLGNSPYLAGDSLTLADLSTGPTVSAVPAAVDIDPATYPKVTAWLDRLNKLPYYKEINEAPAQSYVAFLRSKWTKLGDK
|
|
| PDBID: | 9f7j | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-03 |
|
| PDBID: | 9f7i | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of Borrelia burgdorferi B31 CspZ in complex with human FH SCR6-7 | | Authors: | Brangulis, K., Surth, V., Marcinkiewicz, A.L., Akopjana, I., Kazaks, A., Bogans, J., Huber, A., Lin, Y.-P., Kraiczy, P. | | Deposition date: | 2024-05-03 |
|
