PDBID: | 8z3m | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of the hGPR4-Gq complex in pH6.5 | Authors: | Zhong, Y.N., Guo, L.L., Yang, F., Sun, J.P. | Deposition date: | 2024-04-15 |
|
PDBID: | 8z3n | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of the hGPR4-Gq complex in pH6.5 | Authors: | Zhong, Y.N., Guo, L.L., Yang, F., Sun, J.P. | Deposition date: | 2024-04-15 |
|
PDBID: | 8z3q | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of the hGPR4-Gs complex in pH7.6 | Authors: | Zhong, Y.N., Guo, L.L., Yang, F., Sun, J.P. | Deposition date: | 2024-04-15 |
|
PDBID: | 8z3o | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of the receptor of hGPR68-Gs complex in pH6.0 | Authors: | Zhong, Y.N., Guo, L.L. | Deposition date: | 2024-04-15 |
|
PDBID: | 8z3f | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-15 |
|
PDBID: | 8z3c | Status: | HPUB -- hold until publication | Title: | Dienelactone hydrolase family protein | Authors: | Hwang, J., Lee, J.H., Do, H. | Deposition date: | 2024-04-15 |
|
PDBID: | 8z3a | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-15 |
|
PDBID: | 8z3d | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-15 |
|
PDBID: | 8z3g | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-15 |
|
PDBID: | 8z3h | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-15 |
|
PDBID: | 8z3p | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-15 |
|
PDBID: | 8z3l | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-15 |
|
PDBID: | 8z3i | Status: | HPUB -- hold until publication | Title: | Crystal Structure of Protein Glutaminase FBPG(Flavobacterium sp.316) | Authors: | Long, Y.T., Lan, D.M., Wang, Y.H. | Deposition date: | 2024-04-15 |
|
PDBID: | 8z3j | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-15 |
|
PDBID: | 8z3k | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-15 |
|
PDBID: | 9bee | Status: | HPUB -- hold until publication | Title: | alphaB-crystallin N-terminal IXI variant in a fibril state | Authors: | McFarland, R., Reichow, S.L. | Deposition date: | 2024-04-15 |
|
PDBID: | 9bem | Status: | HPUB -- hold until publication | Title: | Tungstate binding protein (Tungbindin) from Eubacterium limosum with seven Tungstates bound | Authors: | Zhou, D., Rose, J.P., Chen, L., Wang, B.C. | Deposition date: | 2024-04-15 |
|
PDBID: | 9beb | Status: | HPUB -- hold until publication | Title: | Tungstate binding protein (Tungbindin) from Eubacterium limosum with eight Tungstates bound | Authors: | Zhou, D., Rose, J.P., Chen, L., Wang, B.C. | Deposition date: | 2024-04-15 |
|
PDBID: | 9bea | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | SARS CoV-2 full-length spike protein with internal tag, 2RBD-up conformation | Authors: | Singh, S., Hasan, S.S. | Deposition date: | 2024-04-15 |
|
PDBID: | 9be7 | Status: | HPUB -- hold until publication | Title: | Alkalihalobacillus halodurans (Aha) trp RNA binding attenuation protein (TRAP) mutant dTRAP without Trp | Authors: | Yang, H., Stachowski, K., Foster, M. | Deposition date: | 2024-04-15 | Sequence: | >Entity 1 MNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEGGGGSGGGGSMNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEENLYFQ
|
|
PDBID: | 9be8 | Status: | HPUB -- hold until publication | Title: | Alkalihalobacillus halodurans (Aha) trp RNA binding attenuation protein (TRAP) mutant T49A/T52A dTRAP with Trp | Authors: | Yang, H., Stachowski, K., Foster, M. | Deposition date: | 2024-04-15 | Sequence: | >Entity 1 MNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEGGGGSGGGGSMNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFAEHASAVKIRGKAIIQTSYGTLDTEKDEENLYFQ
|
|
PDBID: | 9bec | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-15 |
|
PDBID: | 9bef | Status: | HPUB -- hold until publication | Title: | Structure of S1_8B, a lambda-carrageenan specific sulfatase, in complex with an oligosaccharide | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | Deposition date: | 2024-04-15 |
|
PDBID: | 9beh | Status: | HPUB -- hold until publication | Title: | Structure of GH110A in complex with galactose-6-sulfate | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | Deposition date: | 2024-04-15 |
|
PDBID: | 9bej | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-15 |
|