PDBID: | 9ckh | Status: | PROC -- to be processed | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0e | Status: | PROC -- to be processed | Title: | CryoEM structure of PmcTnsC-dsDNA-AMPPNP in complex with PmcTnsAB hook | Authors: | Finocchio, G., Chanez, C., Querques, I., Speichert, K.J., Jinek, M. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0f | Status: | AUTH -- processed, waiting for author review and approval | Title: | CryoEM structure of PmcTnsC-dsDNA-AMPPNP | Authors: | Finocchio, G., Chanez, C., Querques, I., Speichert, K.J., Jinek, M. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0c | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of human Mical1 bMERB_V978A_V985A domain:Rab10 complex. | Authors: | Rai, A., Goody, R.S. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0d | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of human Mical1 bMERB_V978A domain:Rab10 complex. | Authors: | Rai, A., Goody, R.S. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0m | Status: | AUTH -- processed, waiting for author review and approval | Title: | Trp-cage fortified Tc5b-Exenatide chimera (Ex4-Tc5bER) at 288K | Authors: | Daniel, H. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0j | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of the PRO-PRO endopeptidase (PPEP-3) from Geobacillus thermodenitrificans | Authors: | Claushuis, B., Wojtalla, F., van Leeuwen, H., Corver, J., Baumann, U., Hensbergen, P. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0h | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0i | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0g | Status: | AUTH -- processed, waiting for author review and approval | Title: | BsCdaA in complex with Compound 7 | Authors: | Neumann, P., Ficner, R. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0o | Status: | AUTH -- processed, waiting for author review and approval | Title: | Xenopus borealis undecorated microtubule - 14 protofilament, 3-start helix | Authors: | Troman, L.A., Moores, C.A. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0p | Status: | AUTH -- processed, waiting for author review and approval | Title: | Xenopus laevis undecorated microtubule - 14 protofilament, 3-start helix | Authors: | Troman, L.A., Moores, C.A. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0q | Status: | AUTH -- processed, waiting for author review and approval | Title: | Xenopus laevis undecorated microtubule - 15 protofilament, 3-start helix | Authors: | Troman, L.A., Moores, C.A. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0r | Status: | AUTH -- processed, waiting for author review and approval | Title: | Xenopus laevis undecorated microtubule - 15 protofilament, 4-start helix | Authors: | Troman, L.A., Moores, C.A. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0s | Status: | AUTH -- processed, waiting for author review and approval | Title: | Xenopus tropicalis undecorated microtubule - 14 protofilament, 3-start helix | Authors: | Troman, L.A., Moores, C.A. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0t | Status: | AUTH -- processed, waiting for author review and approval | Title: | Xenopus tropicalis undecorated microtubule - 15 protofilament, 3-start helix | Authors: | Troman, L.A., Moores, C.A. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0l | Status: | HPUB -- hold until publication | Title: | Crystal structure of the RING-ZnF1 fragment of SIAH1 | Authors: | Coste, F., Suskiewicz, M.J. | Deposition date: | 2024-07-08 | Sequence: | >Entity 1 MTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPLEHHHHHH
|
|
PDBID: | 9g0n | Status: | AUTH -- processed, waiting for author review and approval | Title: | Trp-cage fortified Tc5b-Exenatide chimera (Ex4-Tc5bER) at 299K | Authors: | Daniel, H. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0u | Status: | AUTH -- processed, waiting for author review and approval | Title: | Human LTC4 synthase in complex with AZD9898 | Authors: | Srinivas, H. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0v | Status: | AUTH -- processed, waiting for author review and approval | Title: | Human LTC4 synthase in complex with compound 1 | Authors: | Srinivas, H. | Deposition date: | 2024-07-08 |
|
PDBID: | 9io3 | Status: | AUTH -- processed, waiting for author review and approval | Title: | D-Amino Acid Substituted Antimicrobial Peptides Derived from Tilapia piscidin 4 | Authors: | Huang, Y.P., Chang, C.F. | Deposition date: | 2024-07-08 |
|
PDBID: | 9io2 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Tilapia Piscidin-TP2-5 | Authors: | Huang, Y.P., Chang, C.F. | Deposition date: | 2024-07-08 |
|
PDBID: | 9inu | Status: | AUTH -- processed, waiting for author review and approval | Title: | Novel PD-L1/VISTA dual inhibitor as potential immunotherapy agents | Authors: | Cheng, Y., Xiao, Y.B. | Deposition date: | 2024-07-08 |
|
PDBID: | 9io5 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of dimeric F1-like ATPase from Mycoplasma mobile gliding machinery | Authors: | Toyonaga, T., Kato, T., Kawamoto, A., Miyata, T., Kawakami, K., Fujita, J., Hamaguchi, T., Namba, K., Miyata, M. | Deposition date: | 2024-07-08 |
|
PDBID: | 9inn | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-07-08 |
|