| PDBID: | 8wsy | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-17 | | Release date: | 2024-10-17 |
|
| PDBID: | 8wsz | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2023-10-17 | | Release date: | 2024-10-17 |
|
| PDBID: | 8wsa | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-17 |
|
| PDBID: | 8wsv | | Status: | HPUB -- hold until publication | | Title: | Pre-binding structure of HosA transcriptional regulator from enteropathogenic Escherichia coli O127:H6 (strain E2348/69) in presence of sub optimal concentration of 4-hydroxy benzoic acid | | Authors: | Goswami, A., Raju, R., Kasarla, M., Ullah, S. | | Deposition date: | 2023-10-17 | | Sequence: | >Entity 1
MALRNKAFHQLRQLFQQHTARWQHELPDLTKPQYAVMRAIADKPGIEQVALIEAAVSTKATLAEMLARMENRGLVRREHDAADKRRRFVWLTAEGEKVLAAAIPIGDSVDEEFLGRLSAEEQELFMQLVRKMMNTLEHHHHHH
|
|
| PDBID: | 8wt0 | | Status: | HOLD -- hold until a certain date | | Title: | The toxin-antitoxin complex Fic-1-AntF is a deAMPylase that regulates the activity of DNA gyrase | | Authors: | Chen, F.R., Guo, L.W., Lu, C.H., Jiang, W.J., Luo, Z.Q., Liu, J.F., Zhang, L.Q. | | Deposition date: | 2023-10-17 | | Release date: | 2024-10-17 |
|
| PDBID: | 8wry | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8ws3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8wrq | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Cas12-1 with 14 nt complementary heteroduplex | | Authors: | Zhang, K., Zhang, X. | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8ws8 | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM mini structure of Cas12-1/crRNA/Target DNA complex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 | | Release date: | 2024-10-16 |
|
| PDBID: | 8wrv | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM mini structure of Cas12-2/crRNA/Target DNA complex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 | | Release date: | 2024-10-16 |
|
| PDBID: | 8wru | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of Cas12-2/crRNA/Target DNA complex | | Authors: | Kuo, Z., Xi, Z. | | Deposition date: | 2023-10-16 | | Release date: | 2024-10-16 |
|
| PDBID: | 8qun | | Status: | HPUB -- hold until publication | | Title: | human carbonic anhydrase I in complex with 2-((5-cyano-4-hydroxy-6-(p-tolyl)pyrimidin-2-yl)thio)-N-(4-sulfamoylphenyl)acetamide | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2023-10-16 | | Sequence: | >Entity 1
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
| PDBID: | 8qum | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-16 | | Release date: | 2024-10-16 |
|
| PDBID: | 8quo | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8que | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8quf | | Status: | HPUB -- hold until publication | | Title: | carbonic anhydrase XII mimic in complex with 2-(3-((N-(4-sulfamoylbenzyl)pyridine-3-sulfonamido)methyl)phenoxy)acetic acid | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2023-10-16 | | Sequence: | >Entity 1
MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFKVNFDDSQDKAVLKGGPLDGTYRLTQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDASKASQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLNETVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
| PDBID: | 8qup | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8ul7 | | Status: | HPUB -- hold until publication | | Title: | The structure of NanH in complex with Neu5Ac | | Authors: | Medley, B.J., Boraston, A.B. | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8ul9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8uls | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the BG505 SOSIPv2 in complex with bNAb 01_D03 Fabs | | Authors: | DeLaitsch, A.T., Bjorkman, P.J. | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8ult | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of the BG505 SOSIPv2 in complex with bNAb 04_A06 Fabs | | Authors: | DeLaitsch, A.T., Bjorkman, P.J. | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8ul1 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8ul0 | | Status: | HPUB -- hold until publication | | Title: | Structure of rsKiiro using SSX | | Authors: | Baxter, J.M., van Thor, J.J. | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8ul2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of rsKiiro using SSX after illumination with 0.53 mJ/mm^2 of 405 nm light | | Authors: | Baxter, J.M., van Thor, J.J. | | Deposition date: | 2023-10-16 |
|
| PDBID: | 8ul3 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of rsKiiro using SSX after illumination with 1.78 mJ/mm^2 of 405 nm light | | Authors: | Baxter, J.M., van Thor, J.J. | | Deposition date: | 2023-10-16 |
|
