PDBID: | 9fvn | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-27 |
|
PDBID: | 9ike | Status: | HPUB -- hold until publication | Title: | Crystal structure of CDK12/Cyclin K in complex with covalent inhibitor | Authors: | Huang, W.X., Zhou, K.J., Yang, J.Z., Ding, K. | Deposition date: | 2024-06-27 |
|
PDBID: | 9ikf | Status: | HPUB -- hold until publication | Title: | Bovine Heart Cytochrome c Oxidase in the Carbon Dioxide-bound Fully Oxidized State | Authors: | Muramoto, K., Shinzawa-Itoh, K. | Deposition date: | 2024-06-27 |
|
PDBID: | 9ikg | Status: | HPUB -- hold until publication | Title: | Bovine Heart Cytochrome c Oxidase in the Carbon Dioxide-bound Fully Reduced State | Authors: | Muramoto, K., Shinzawa-Itoh, K. | Deposition date: | 2024-06-27 |
|
PDBID: | 9ikh | Status: | HPUB -- hold until publication | Title: | Bovine Heart Cytochrome c Oxidase in the Nitrous Oxide-bound Fully Oxidized State | Authors: | Muramoto, K., Ide, T., Shinzawa-Itoh, K. | Deposition date: | 2024-06-27 |
|
PDBID: | 9iki | Status: | HPUB -- hold until publication | Title: | Bovine Heart Cytochrome c Oxidase in the Nitrous Oxide-bound Fully Reduced State | Authors: | Muramoto, K., Ide, T., Shinzawa-Itoh, K. | Deposition date: | 2024-06-27 |
|
PDBID: | 9ikb | Status: | HPUB -- hold until publication | Title: | Crystal structure of heterotrimeric Kinesin-2 | Authors: | Ren, J., Zhao, L., Feng, W. | Deposition date: | 2024-06-27 | Sequence: | >Entity 1 HHHHSQDGGAYSDERQDLDQTIAEVSKELKLKLLIVENFIPRDVSERIKERAEWNEDSFEWNVNAFQSTSSNSSTPLNNTIEVNEDGVFTRSSGADSGVSVSGGNGTPATSQFLDKRLVATPGCRRPMSMCERMLVETAREQFGAQRRPPISGSGSFVEATIPEETIRFCGENVVVFSALERFVPEVTDSDPSTFSNSMMMSARRPSIENLTIDASKVLVPILNQSTMILKNSKNGQARNDTMPPNGSMRRSQN
>Entity 2 EDHQRQVEAMLDDIRQLRKELLLNIAIIDEYIPVEHVELIEKYVSWSEEHGDWQLKAIAYTGNNMRASAPPAKKEFSNNNQTVPMYYSYRADLGASTAEHRPRTSSKKHRASIRLQQLLT
>Entity 3 ELGKIDEYIECFYGETSVEKNKGAVALYELSKNPQNLTQLVNNETLMMALARVFREDWKKHFEVGTNIMNLFVNISKFSCLHGILLHHKIGTLCVNAMEHETKRYDFWIAEMKKTDQETLRKLKTAIRKQAMLLAACVTFLTNLATDISVELKMVRRNLVALLVKCLQMSSESTSSLTTATIKFLLKLSIFDENKIVMEQNGTIEKLLKLFPIQDPELRKAVIMLLFNFSFDSKNLPKMVNGGLVPHMASLLDSDTKALNMMYLLSCNDDAKAMLAYTDAIKLLMKDVLSGTGSEVTKAVLLNICLEKRNAQLVCGQRGQGLDLLMEMSINSRDLMLIKVVRAISSHEGATQNMFLKWIETLIGIAKNEGADNSESKSSFGLECMGTVAELKVAPWAKIIQSENLVPWMKTQLQEGIDESEEVTVLRDIKPLQLQIVIACGTMARQLDAARLLAPLIDTFVQLLQSCQIDDEFVVQLLYVFLQFLKHKELSARLMTQDSALGAHMIDLMHDANAVVREVCDNALLIMGEHSKEWAKRIAGERFKWHNAQWLEMVERDDSEFVDYDDEDFGADLKFDHYDDGFDMNEPLF
|
|
PDBID: | 9ikd | Status: | HOLD -- hold until a certain date | Title: | The apo structure of the MazF-mt3 toxin | Authors: | Xie, W., Jiang, P. | Deposition date: | 2024-06-27 | Release date: | 2025-06-27 |
|
PDBID: | 9ikj | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-27 |
|
PDBID: | 9ikk | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-27 |
|
PDBID: | 9ikl | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-27 |
|
PDBID: | 9ikm | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-27 |
|
PDBID: | 9cfu | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of myosin-1c bound to F-actin in the ADP-A state | Authors: | Chavali, S.S., Sindelar, C.V., Ostap, E.M. | Deposition date: | 2024-06-27 |
|
PDBID: | 9cfx | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of myosin-1c bound to F-actin in the Rigor state | Authors: | Chavali, S.S., Sindelar, C.V., Ostap, E.M. | Deposition date: | 2024-06-27 |
|
PDBID: | 9cft | Status: | HPUB -- hold until publication | Title: | Adeno-associated virus serotype 6 basic regions in complex with importin alpha 2 | Authors: | Hoad, M., Forwood, J.K. | Deposition date: | 2024-06-27 |
|
PDBID: | 9cfn | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-27 |
|
PDBID: | 9cf9 | Status: | HPUB -- hold until publication | Title: | SARS-CoV-2 3CL Protease complexed with covalent inhibitor BC787 | Authors: | Hoffpauir, Z.A., Meneely, K.M., Lamb, A.L. | Deposition date: | 2024-06-27 |
|
PDBID: | 9cfa | Status: | HPUB -- hold until publication | Title: | Germline-targeting HIV-1 gp120 engineered outer domain eODgt8 in complex with Fab eOD-CL04.1 | Authors: | Sarkar, A., Stanfield, R.L., Wilson, I.A. | Deposition date: | 2024-06-27 |
|
PDBID: | 9cf6 | Status: | HPUB -- hold until publication | Title: | Germline-targeting HIV-1 gp120 engineered outer domain eODgt8 in complex with Fab eOD-CL02.1 | Authors: | Sarkar, A., Stanfield, R.L., Wilson, I.A. | Deposition date: | 2024-06-27 |
|
PDBID: | 9cf7 | Status: | HPUB -- hold until publication | Title: | Germline-targeting HIV-1 gp120 engineered outer domain eODgt8 in complex with Fab eOD-PL01.1 | Authors: | Sarkar, A., Stanfield, R.L., Wilson, I.A. | Deposition date: | 2024-06-27 |
|
PDBID: | 9cf5 | Status: | HPUB -- hold until publication | Title: | STRUCTURE OF CD4 MIMETIC CJF-III-288 IN COMPLEX WITH BG505 SOSIP.664 HIV-1 ENV TRIMER AND 17B FAB | Authors: | Niu, L., Tolbert, W.D., Pazgier, M. | Deposition date: | 2024-06-27 |
|
PDBID: | 9cfc | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of human kidney V-ATPase state 2 | Authors: | Zhang, Z., Lyu, M. | Deposition date: | 2024-06-27 |
|
PDBID: | 9cfb | Status: | HPUB -- hold until publication | Title: | SARS-CoV-2 3CL Protease complexed with covalent inhibitor BC674 | Authors: | Hoffpauir, Z.A., Meneely, K.M., Lamb, A.L. | Deposition date: | 2024-06-27 |
|
PDBID: | 9cfs | Status: | HPUB -- hold until publication | Title: | Structure of a 150% lengthened variant of the E. coli ROP protein | Authors: | Gallagher, D.T., Shakya, A. | Deposition date: | 2024-06-27 |
|
PDBID: | 9cfd | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2024-06-27 |
|