| PDBID: | 9e7x | | Status: | HPUB -- hold until publication | | Title: | Canine parvovirus subtype 2a empty capsid in complex with Fab fragments of Mab 2C5 | | Authors: | Lee, H., Hafenstein, S. | | Deposition date: | 2024-11-04 |
|
| PDBID: | 9e7y | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-04 |
|
| PDBID: | 9e7z | | Status: | HPUB -- hold until publication | | Title: | Canine parvovirus subtype 2a empty capsid in complex with Fab fragments of Mab 3G6 | | Authors: | Lee, H., Hafenstein, S. | | Deposition date: | 2024-11-04 |
|
| PDBID: | 9e80 | | Status: | HPUB -- hold until publication | | Title: | Canine parvovirus subtype 2a empty capsid in complex with Fab fragments of Mab 2C5 | | Authors: | Lee, H., Hafenstein, S. | | Deposition date: | 2024-11-04 |
|
| PDBID: | 9ke2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of SxRhaGT in complex with TDP | | Authors: | Tingting, Y. | | Deposition date: | 2024-11-04 |
|
| PDBID: | 9kdu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-04 |
|
| PDBID: | 9kdv | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of 80S ribosome | | Authors: | Lu, Y., Wang, X., Qin, Y., Cao, Y. | | Deposition date: | 2024-11-04 |
|
| PDBID: | 9ke1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of ScRhaGT in complex with TDP | | Authors: | Tingting, Y. | | Deposition date: | 2024-11-04 |
|
| PDBID: | 9kdw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-04 |
|
| PDBID: | 9kdt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-04 |
|
| PDBID: | 9ke8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of HdNadV and its complex with NMN | | Authors: | Lin, T., Zhengjuan, W. | | Deposition date: | 2024-11-04 |
|
| PDBID: | 9kdx | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of thioredoxin gluthathione reductase from Schistosoma japonicum with the U597C mutation in complex with GSH | | Authors: | Wang, S.Q., Huang, S.Q., Lin, T.W. | | Deposition date: | 2024-11-04 |
|
| PDBID: | 9kdr | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of TrkA kinase in complex with RT1 | | Authors: | Zhang, Z.M., Wang, L. | | Deposition date: | 2024-11-04 |
|
| PDBID: | 9kds | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of human AURKA kinase domain in complex with RA1 | | Authors: | Zhang, Z.M., Wang, L. | | Deposition date: | 2024-11-04 |
|
| PDBID: | 9kdy | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of thioredoxin gluthathione reductase from Schistosoma japonicum with the U597C mutation in complex with auranofin | | Authors: | Wang, S.Q., Huang, S.Q., Lin, T.W. | | Deposition date: | 2024-11-04 |
|
| PDBID: | 9kdz | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the oxidized state of TRP14 from Schistosoma japonicum | | Authors: | Wang, S.Q., Huang, S.Q., Lin, T.W. | | Deposition date: | 2024-11-04 |
|
| PDBID: | 9ke0 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the reduced state of TRP14 from Schistosoma japonicum | | Authors: | Wang, S.Q., Huang, S.Q., Lin, T.W. | | Deposition date: | 2024-11-04 |
|
| PDBID: | 9ke4 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the oxidized state of Trx1 from Schistosoma japonicum | | Authors: | Wang, S.Q., Huang, S.Q., Lin, T.W. | | Deposition date: | 2024-11-04 |
|
| PDBID: | 9ke6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the reduced state of Trx1 from Schistosoma japonicum | | Authors: | Wang, S.Q., Huang, S.Q., Lin, T.W. | | Deposition date: | 2024-11-04 |
|
| PDBID: | 9ke5 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-11-04 | | Release date: | 2025-11-04 |
|
| PDBID: | 9ke3 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-04 | | Release date: | 2025-11-04 |
|
| PDBID: | 9kea | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of LnzB (Streptomyces spp. ) | | Authors: | Zhang, Z.M., Wang, L. | | Deposition date: | 2024-11-04 |
|
| PDBID: | 9ke9 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-11-04 | | Release date: | 2025-11-04 |
|
| PDBID: | 9kee | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-04 | | Sequence: | >Entity 1
MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLMLEHHHHHH
|
|
| PDBID: | 9ke7 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the PIN1 and fragment 23 complex. | | Authors: | Xiao, Q.J., Wu, T.T., Shu, H.L., Qin, W.M. | | Deposition date: | 2024-11-04 | | Release date: | 2025-11-04 |
|
