| PDBID: | 9v9a | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-30 |
|
| PDBID: | 9ovk | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-30 |
|
| PDBID: | 9ovn | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-30 |
|
| PDBID: | 9ovm | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-30 |
|
| PDBID: | 9ovp | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-30 |
|
| PDBID: | 9ovr | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-05-30 |
|
| PDBID: | 9ovh | | Status: | HPUB -- hold until publication | | Title: | Structure of an ancestral ethylene forming enzyme, Anc357, in complex with Mn | | Authors: | Chatterjee, S., Rankin, J.A., Farrugia, M.A., Hu, J., Hausinger, R.P. | | Deposition date: | 2025-05-30 |
|
| PDBID: | 9ovo | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-30 |
|
| PDBID: | 9ovg | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-30 |
|
| PDBID: | 9ovs | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-05-30 |
|
| PDBID: | 9ovq | | Status: | HPUB -- hold until publication | | Title: | PAD2 with an inhibitor | | Authors: | Yamaguchi, M. | | Deposition date: | 2025-05-30 |
|
| PDBID: | 9ovl | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-30 |
|
| PDBID: | 9rd2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-30 |
|
| PDBID: | 9rd3 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-05-30 |
|
| PDBID: | 9rd0 | | Status: | HPUB -- hold until publication | | Title: | Structure of DabA2B2 complex solved under ambient condition | | Authors: | Lo, Y.K., Bohn, S., Schuller, J. | | Deposition date: | 2025-05-30 |
|
| PDBID: | 9rd1 | | Status: | HPUB -- hold until publication | | Title: | OppA from E. coli in complex with GSisoK | | Authors: | Iype, T., Fottner, M., Boehm, P., Piedrafita, C., Moeller, Y., Groll, M., Lang, K. | | Deposition date: | 2025-05-30 | | Sequence: | >Entity 1
ADVPAGVTLAEKQTLVRNNGSEVQSLDPHKIEGVPESNISRDLFEGLLVSDLDGHPAPGVAESWDNKDAKVWTFHLRKDAKWSDGTPVTAQDFVYSWQRSVDPNTASPYASYLQYGHIAGIDEILEGKKPITDLGVKAIDDHTLEVTLSEPVPYFYKLLVHPSTSPVPKAAIEKFGEKWTQPGNIVTNGAYTLKDWVVNERIVLERSPTYWNNAKTVINQVTYLPIASEVTDVNRYRSGEIDMTNNSMPIELFQKLKKEIPDEVHVDPYLCTYYYEINNQKPPFNDVRVRTALKLGMDRDIIVNKVKAQGNMPAYGYTPPYTDGAKLTQPEWFGWSQEKRNEEAKKLLAEAGYTADKPLTINLLYNTSDLHKKLAIAASSLWKKNIGVNVKLVNQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSNSSMNTAHYKSPAFDSIMAETLKVTDEAQRTALYTKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNTYTRNMYIVKHHHHHH
|
|
| PDBID: | 9rcx | | Status: | HPUB -- hold until publication | | Title: | Structure of protein kinase CK2alpha mutant T127M associated with the Okur-Chung Neurodevelopmental Syndrome | | Authors: | Werner, C., Gast, A., Jose, J., Niefind, K. | | Deposition date: | 2025-05-30 |
|
| PDBID: | 9rcy | | Status: | HPUB -- hold until publication | | Title: | Structure of protein kinase CK2alpha mutant R21Q associated with the Okur-Chung Neurodevelopmental Syndrome | | Authors: | Werner, C., Gast, A., Jose, J., Niefind, K. | | Deposition date: | 2025-05-30 |
|
| PDBID: | 9rcw | | Status: | HPUB -- hold until publication | | Title: | Primed-state RyR1 in 0.01% POPC micelles, in complex with a nanobody and FKBP12 | | Authors: | Li, C., Efremov, R.G. | | Deposition date: | 2025-05-30 |
|
| PDBID: | 9v87 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9v88 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9v81 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-05-29 | | Release date: | 2026-05-29 |
|
| PDBID: | 9v8d | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9v85 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9v86 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-29 |
|
