| PDBID: | 9niv | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9nj7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9niy | | Status: | HPUB -- hold until publication | | Title: | Fab1393 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein | | Authors: | Moskovitz, R., Wilson, I.A. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9nj3 | | Status: | HPUB -- hold until publication | | Title: | Computationally optimized broadly reactive influenza B hemagglutinin BC2 bound by antibodies #46 and #3978 | | Authors: | Dzimianski, J.V., Kunkel, I., Balasco Serrao, V.H., DuBois, R.M. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9nj4 | | Status: | HPUB -- hold until publication | | Title: | Fab1437 in complex with the C-terminal alpha-TSR domain of the P. falciparum circumsporozoite protein | | Authors: | Moskovitz, R., Wilson, I.A. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9nj6 | | Status: | HPUB -- hold until publication | | Title: | Computationally optimized broadly reactive influenza B hemagglutinin BC2 bound by antibody #3978 | | Authors: | Dzimianski, J.V., Kunkel, I., Balasco Serrao, V.H., DuBois, R.M. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9nj8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9nj1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q9f | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q9h | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q9j | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q9k | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q9m | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q9s | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q9l | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q9p | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-02-26 | | Release date: | 2026-02-26 |
|
| PDBID: | 9q9n | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q9q | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-02-26 | | Release date: | 2026-02-26 |
|
| PDBID: | 9q99 | | Status: | HPUB -- hold until publication | | Title: | CK2, catalytic subunit alpha'' (CSNK2A2 gene product) in complex with F2X-Entry screen fragment B06 | | Authors: | Werner, C., Harasimowicz, H., Barthel, T., Weiss, M.S., Niefind, K. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q9o | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-02-26 | | Release date: | 2026-02-26 |
|
| PDBID: | 9q9u | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q9e | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of a TELSAM-SUMO1 fusion protein | | Authors: | Coste, F., Mishra, A., Suskiewicz, M.J. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q9t | | Status: | HPUB -- hold until publication | | Title: | Human ROCK2 in complex with a dihydropyrazolo-pyrimidine inhibitor | | Authors: | Pala, D., Clark, D., Accetta, A., Rancati, F., Edwards, C. | | Deposition date: | 2025-02-26 | | Sequence: | >Entity 1
GAAGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFPALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMDETGMVHCDTAVGTPDYISPEVLKSQGGDGFYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIRQHPFFKNDQWHWDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYR
|
|
| PDBID: | 9q92 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | CryoEM structure of bacterial transcription intermediate complex mediated by activator PspF containing nifH promoter DNA containing mismatch from -11 to -8 - conformation 5 | | Authors: | Gao, F., Zhang, X. | | Deposition date: | 2025-02-26 |
|
| PDBID: | 9q9a | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-26 |
|
