| PDBID: | 9i45 | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 16-3-10B Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 | | Sequence: | >Entity 1
QSALTQPASVSGSPGQSITISCTGTSSIFGSYYLVSWYQQYPGKAPKLIVYEGSKRPSGVSNRFSGSKSGNTASLTISGLQAEDEAAYYCCSYAGTRTYVFGTGTKLTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADKSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
>Entity 2
EVQLVQSGSELKKPGASVKVSCKVSRSTFVNYAVNWVRQAPGQGLEWMGWINTNTGNPTYAQGFTGRFVFSLDTSVSTAYLLISGLKADDSAVYYCAYDPLGNWFDPWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKHHHHHH
|
|
| PDBID: | 9i4c | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 17-1-12A Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i4d | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 17-2-2B Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i4b | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 17-2-12A Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i4e | | Status: | HPUB -- hold until publication | | Title: | Structure of anti-EV71 human monoclonal antibody 34-1-6D Fab | | Authors: | Zhou, D., Ren, J., Stuart, D.I. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i4j | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of the drug binding domain of AlbA in complex with the KMR-04-161 compound of the pyrrolobenzodiazepines class | | Authors: | Di Palma, M., Steiner, R.A. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9i3t | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0k | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of KABLE triple mutant (Ile12Phe, Lys14Pro, Leu20Trp) | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0i | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of KABLE double mutant (Lys14Pro, Leu20Trp) | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0x | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n17 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n16 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n19 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n18 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n13 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n12 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n14 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n15 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0j | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of KABLE double mutant (Lys14Pro, Leu20Trp) in complex with 6-nitrobenzotriazole | | Authors: | Correy, G.J., Fraser, J.S. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0l | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-01-24 | | Release date: | 2026-01-24 |
|
| PDBID: | 9n0v | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the HIV capsid hexamer bound to the small molecule long-acting inhibitor, KFA-027 | | Authors: | Dinh, T.T., Kvaratskhelia, M. | | Deposition date: | 2025-01-24 | | Release date: | 2025-07-24 |
|
| PDBID: | 9n0o | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-01-24 | | Release date: | 2026-01-24 |
|
| PDBID: | 9n0p | | Status: | HPUB -- hold until publication | | Title: | Open tetramer | | Authors: | Gupta, J., Izard, T. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0w | | Status: | HPUB -- hold until publication | | Title: | HTLV-1 Gag capsid from immature particles | | Authors: | Arndt, W.G., Ramezani, A., Chen, B., Perilla, J.R., Zhang, W., Mansky, L.M. | | Deposition date: | 2025-01-24 |
|
| PDBID: | 9n0n | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2025-01-24 |
|
