| PDBID: | 9keu | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Mycobacterium tuberculosis transcription activation complex with four PhoP molecules (composite map) | | Authors: | Lin, W., Feng, Y. | | Deposition date: | 2024-11-05 |
|
| PDBID: | 9kev | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Mycobacterium tuberculosis transcription activation complex with six PhoP molecules (composite map) | | Authors: | Lin, W., Feng, Y. | | Deposition date: | 2024-11-05 |
|
| PDBID: | 9kex | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-05 |
|
| PDBID: | 9kem | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-11-05 | | Release date: | 2025-11-05 |
|
| PDBID: | 9kf5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-05 |
|
| PDBID: | 9kf8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-05 |
|
| PDBID: | 9kf9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-05 |
|
| PDBID: | 9kf7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-05 |
|
| PDBID: | 9kfa | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-05 |
|
| PDBID: | 9kf1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-05 |
|
| PDBID: | 9kf2 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-05 |
|
| PDBID: | 9kf3 | | Status: | PROC -- to be processed | | Title: | Crystal structure of Streptomyces sp. sulfotransferase Cpz8 in complex with PAP and Presulficidin-analog, involved in Caprazamycins synthesis | | Authors: | Iwamoto, Y., Watanabe, M., Suzuki, K., Teramoto, T., Kakuta, Y. | | Deposition date: | 2024-11-05 |
|
| PDBID: | 9kf4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-05 |
|
| PDBID: | 9kf6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the reaction intermediate of Streptomyces sp. sulfotransferase Cpz4 involved in caprazamycins synthesis | | Authors: | Iwamoto, Y., Watanabe, M., Suzuki, K., Teramoto, T., Kakuta, Y. | | Deposition date: | 2024-11-05 |
|
| PDBID: | 9kef | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-05 |
|
| PDBID: | 9kej | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-05 |
|
| PDBID: | 9ken | | Status: | HPUB -- hold until publication | | Title: | cryo-EM structure of TRIP12 in complex with K29/48 branched-triUb | | Authors: | Ai, H.S., Wu, X.W., Liu, L. | | Deposition date: | 2024-11-05 |
|
| PDBID: | 9keg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-05 | | Sequence: | >Entity 1
MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLMLEHHHHHH
|
|
| PDBID: | 9keh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-05 | | Sequence: | >Entity 1
MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLMLEHHHHHH
|
|
| PDBID: | 9kei | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-05 | | Sequence: | >Entity 1
MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLMLEHHHHHH
|
|
| PDBID: | 9kek | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-05 | | Sequence: | >Entity 1
MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKMATLMLEHHHHHH
|
|
| PDBID: | 9kep | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-05 |
|
| PDBID: | 9kel | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the PIN1 and fragment 26 complex. | | Authors: | Xiao, Q.J., Wu, T.T., Shu, H.L., Qin, W.M. | | Deposition date: | 2024-11-05 | | Release date: | 2025-11-05 |
|
| PDBID: | 9keq | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of the PIN1 and fragment 27 complex. | | Authors: | Xiao, Q.J., Wu, T.T., Shu, H.L., Qin, W.M. | | Deposition date: | 2024-11-05 | | Release date: | 2025-11-05 |
|
| PDBID: | 9ker | | Status: | HPUB -- hold until publication | | Title: | Crystal structure analysis of phosphoglycerate kinase 1 | | Authors: | Runhua, L., Wei, Z. | | Deposition date: | 2024-11-05 |
|
