| PDBID: | 8qju | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qjp | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qjq | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qji | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of GSK3b in complex with N-(4-(5-(1,2,4-oxadiazol-3-yl)thiophen-2-yl)pyridin-2-yl)cyclopropanecarboxamide inhibitor (TW362) | | Authors: | Slugocka, E.A., Grygier, P., Wichur, T., Czarna, A., Wieckowska, A. | | Deposition date: | 2023-09-13 | | Sequence: | >Entity 1
MKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVS(PTR)ICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARENLYFQ
|
|
| PDBID: | 8qje | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qjf | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qjv | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qjh | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qjn | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qjo | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qjd | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qjc | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qjg | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 | | Release date: | 2024-12-13 |
|
| PDBID: | 8u5w | | Status: | HPUB -- hold until publication | | Title: | De novo designed pentameric helical bundle protein | | Authors: | Bick, M.J., Xu, C., Sankaran, B., Baker, D. | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8u5x | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8u5v | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8wcm | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8wcu | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Bacterial ferritin mutant-E4FY | | Authors: | Zhao, G., Zeng, R. | | Deposition date: | 2023-09-13 |
|
| PDBID: | 8qiz | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Crystal structure of Paradendryphiella salina PL7C alginate lyase mutant H124 soaked with with penta-mannuronic acid | | Authors: | Wilkens, C. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8qj6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of cytochrome domain 1 from PgcA | | Authors: | Nash, B.W., Edwards, M.J., Clarke, T.A. | | Deposition date: | 2023-09-12 | | Release date: | 2024-12-12 |
|
| PDBID: | 8qj2 | | Status: | HPUB -- hold until publication | | Title: | Structure of active state MC4R in complex with a potent ligand mimicking nanobody | | Authors: | Busch, A., Jaakola, V.-P., Masiulis, S. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8qj9 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8qj1 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-09-12 | | Release date: | 2024-09-12 |
|
| PDBID: | 8qj5 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the Levansucrase beta from Pseudomonas syringae pv. actinidiae | | Authors: | Ferraroni, M., Peritore, L. | | Deposition date: | 2023-09-12 |
|
| PDBID: | 8qie | | Status: | HPUB -- hold until publication | | Title: | CRYO-EM STRUCTURE OF LEISHMANIA MAJOR 80S RIBOSOME : LM32Cs1C1 mutant snoRNA overexpression, class 4 | | Authors: | Rajan, K.S., Yonath, A., Bashan, A. | | Deposition date: | 2023-09-12 |
|
