| PDBID: | 8v3g | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8v3a | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8v35 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8v36 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8v37 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8v3f | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x89 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Streptococcus pneumoniae fabG | | Authors: | Xu, K.M. | | Deposition date: | 2023-11-27 | | Sequence: | >Entity 1
MKLEHKNIFITGSSRGIGLAIAHKFAQAGANIVLNSRGAISEELLAEFSNYGIKVVPISGDVSDFADAKRMIDQAIAELGSVDVLVNNAGITQDTLMLKMTEADFEKVLKVNLTGAFNMTQSVLKPMMKAREGAIINMSSVVGLMGNIGQANYAASKAGLIGFTKSVAREVASRNIRVNVIAPGMIESDMTAILSDKIKEATLAQIPMKEFGQAEQVADLTVFLAGQDYLTGQVIAIDGGLSM
|
|
| PDBID: | 8x8e | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Mycobacterium tuberculosis transcription activation complex with two PhoP molecules | | Authors: | Lin, W., Shi, J. | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x8d | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Mycobacterium tuberculosis transcription initiation complex with four GlnR and two PhoP molecules | | Authors: | Lin, W., Shi, J. | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x86 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x8b | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x8i | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x8f | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of lipoxygenase from Enhygromyxa salina | | Authors: | Kim, J.W., Seo, P.W., Kim, J.S. | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8x8h | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-11-27 | | Release date: | 2024-11-27 |
|
| PDBID: | 8x8j | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 8r7n | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-26 |
|
| PDBID: | 8v32 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-26 |
|
| PDBID: | 8x7v | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-11-26 | | Release date: | 2024-11-26 |
|
| PDBID: | 8x7w | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-11-26 | | Release date: | 2024-11-26 |
|
| PDBID: | 8r7j | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-11-25 | | Release date: | 2024-11-25 |
|
| PDBID: | 8r7k | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-11-25 | | Release date: | 2024-11-25 |
|
| PDBID: | 8r7l | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-11-25 | | Release date: | 2024-11-25 |
|
| PDBID: | 8x7s | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of tlr0611 | | Authors: | Su, J.Y. | | Deposition date: | 2023-11-25 |
|
| PDBID: | 8r7c | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-24 |
|
| PDBID: | 8r7b | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-24 |
|
