| PDBID: | 8z6h | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6f | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6j | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6l | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6m | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z7a | | Status: | HOLD -- hold until a certain date | | Title: | Open Barrel Structure of Translin from Trichoderma virens | | Authors: | Kumari, S., Gupta, G.D. | | Deposition date: | 2024-04-19 | | Release date: | 2025-04-19 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMAAPPPALLDPSIFASLEAKLEEETQIRDTLSQLIQRLDRAVATAQGLLSRVHSTPRSRYPQLVSQVEAAVKEEAAIISELDTVASKHPYYKYNQRWTRSMQHAIGTAIYCAWLGGFPSQSSESEASSPAEIGRLLTLEEVGTIFSVPTNLKDRDAFHITIEEYLLSLVDLTQDLSRLATNSVTLGDFQLPLTISAFVKDLFAGFQLLNLKNDIIRKRADSVKYEVKRVEDIVYDLSLRGLIQRPGAGDTEMEAAE
|
|
| PDBID: | 8z6e | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-19 | | Release date: | 2025-04-19 |
|
| PDBID: | 8z6d | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-19 | | Release date: | 2025-04-19 |
|
| PDBID: | 8z6w | | Status: | HPUB -- hold until publication | | Title: | Structure of EG.5.1 S trimer with 3 down-RBDs complex with antibody CYFN1006-2. | | Authors: | Wang, Y.J., Sun, L. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6z | | Status: | HPUB -- hold until publication | | Title: | Medium-chain dehydrogenase/reductase MrADH-WT | | Authors: | Xue, J.Y., Xu, G.C., Ni, Y. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z71 | | Status: | HPUB -- hold until publication | | Title: | State 1a (S1a) of yeast 80S ribosome bound to open eEF3 and 2 tRNAs and eEF1A during mRNA decoding | | Authors: | Cheng, J., Wu, C.L., Li, J.X., Zhang, X.Z. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6k | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6o | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HDGFRP2 PWWP domain in complex with Varenicline | | Authors: | Wei, X., Ruan, K. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6p | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Procerain-B from Calotropis gigantea | | Authors: | Kumar, A., Jamdar, S.N., Makde, R.D. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z79 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z6v | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z72 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | MMS-ATM/Tel1 in Open state | | Authors: | Wang, P. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z7b | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SARS-CoV-2 S trimer in the early fusion intermediate conformation (E-FIC) (focused refinement of NTD-SD1-RBD-ACE2) | | Authors: | Liu, Z., Xing, L. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z74 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 8z78 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Procerain-B from Calotropis gigantea with glycerol | | Authors: | Kumar, A., Jamdar, S.N., Makde, R.D. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 9bgu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-19 |
|
| PDBID: | 7h60 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | THE 1.875 A CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH 3-[[ethoxycarbonyl(methyl)amino]methyl]-5-fluoro-1-(naphthalen-1-ylmethyl)indole-2-carboxylic acid - ZN CRYSTAL FORM | | Authors: | Banner, D.W., Benz, J.M., Schlatter, D., Hilpert, H. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 7h61 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | THE 1.76 A CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH N-[2-[6-ethyl-2-[(2-hydroxy-5-oxo-3-phenylcyclopenten-1-yl)-phenylmethyl]-1H-indol-3-yl]ethyl]acetamide | | Authors: | Banner, D.W., Benz, J.M., Schlatter, D., Hilpert, H. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 7h62 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | THE 1.61 A CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH 5-fluoro-3-methyl-N-[4-pyridin-4-yl-2-(trifluoromethyl)phenyl]-1-benzothiophene-2-sulfonamide | | Authors: | Banner, D.W., Benz, J.M., Schlatter, D., Wessel, H.P. | | Deposition date: | 2024-04-19 |
|
| PDBID: | 7h63 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | THE 1.65 A CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH 4-[(5-fluoro-3-propan-2-yl-1H-indol-2-yl)-phenylmethyl]-3-hydroxy-2-propan-2-yl-1,2-dihydropyrrol-5-one (VINYLOGOUS ACID) | | Authors: | Banner, D.W., Benz, J.M., Schlatter, D., Hilpert, H. | | Deposition date: | 2024-04-19 |
|
