| PDBID: | 9knf | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-11-18 | | Release date: | 2025-11-18 |
|
| PDBID: | 9kn2 | | Status: | HPUB -- hold until publication | | Title: | Crystallization of zinc metalloproteinase PepO from Porphyromonas gingivalis | | Authors: | Feng, C.Y., Feng, C.Y. | | Deposition date: | 2024-11-18 | | Sequence: | >Entity 1
NKGQTNDTDRKREPVPAIDLSAMDTSVRPQDDFYRYCNGNWMKNNPLKPAYSRYGSFDILHDSTLERVHLIVDNLAAGQHEVGTNEYRIATLYRQAMDSIKRNKDGAAPLKEDLQKIEAIADRAAMVKYAAAKDNMGGSTFFGSYVYADAKNSEMNIFHITQTGLALDNRDYYLKQDAKSQQIREAYVAYLNKIAKLAGYDDEAATRIAKNAMKMETELAQICYSKEELRDTHRNYNKMAVKEFTNKYQGFDWTTYLADRQLTTLEEWDVEQLDFFKKFDSWFAKADLNEMRDYLLAGTISGAASYLSDDFEQARFDFFGKTLSGTTEMHPRWKRSVGMVSSFLGEALGEVYVKQYFPPEAKERMLKLVKNLQTALGERINMLTWMGDSTKMKAQEKLNSFIIKIGYPDKWKDYSKMEIKGDSYYADIKRASKWMHDDNMADLGKTVDRERWLMNPQDVNAYYNPTTNEICFPAAILQPPFFNMDADDAVNYGGIGVVIGHEMTHGFDDQGRNFDKDGNMINWWTAEDAQKFETTARKLADQFSEIYVADGVRANGNMTLGENIADQGGLLISYLAFRNAAKGEVMEEIDGFTPDQRFFIGYARLWGQNIRPEEVLRLTQIDVHSLGELRVNQALRNIEAFYEAFNIQPTDKMYLEPEKRVVVW
|
|
| PDBID: | 9kne | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-11-18 | | Release date: | 2025-11-18 |
|
| PDBID: | 9knc | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-11-18 | | Release date: | 2025-11-18 |
|
| PDBID: | 9knd | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-11-18 | | Release date: | 2025-11-18 |
|
| PDBID: | 9kn9 | | Status: | HPUB -- hold until publication | | Title: | NSD2-PWWP1 domain bound with compound 1. | | Authors: | Huang, Y., Li, Y., Min, J. | | Deposition date: | 2024-11-18 |
|
| PDBID: | 9kna | | Status: | HPUB -- hold until publication | | Title: | NSD2-PWWP1 domain bound with compound 6 | | Authors: | Huang, Y., Li, Y., Min, J. | | Deposition date: | 2024-11-18 |
|
| PDBID: | 9kn3 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-18 |
|
| PDBID: | 9kn5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-18 |
|
| PDBID: | 9kn6 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-18 |
|
| PDBID: | 9knb | | Status: | HPUB -- hold until publication | | Title: | NSD2-PWWP1 domain bound with compound 9 | | Authors: | Huang, Y., Li, Y., Min, J. | | Deposition date: | 2024-11-18 |
|
| PDBID: | 9kn7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Horse spleen L-ferritin mutant (Fr-E53F/E56F/E57F/R59L/E60F/E63F) | | Authors: | Suzuki, T., Hishikawa, Y., Maity, B., Abe, S., Ueno, T. | | Deposition date: | 2024-11-18 |
|
| PDBID: | 9kn8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Horse spleen L-ferritin mutant (E53F/E56F/E57F/R59F/E60F/E63F) with Coumarin 153 | | Authors: | Suzuki, T., Hishikawa, Y., Maity, B., Abe, S., Ueno, T. | | Deposition date: | 2024-11-18 |
|
| PDBID: | 9knh | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-11-18 | | Release date: | 2025-11-18 |
|
| PDBID: | 9kng | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-11-18 | | Release date: | 2025-11-18 |
|
| PDBID: | 9hfk | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-17 |
|
| PDBID: | 9edm | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-17 |
|
| PDBID: | 9edn | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-17 |
|
| PDBID: | 9edp | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-17 |
|
| PDBID: | 9edo | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-11-17 |
|
| PDBID: | 9edq | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-17 |
|
| PDBID: | 9edr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Tubulin Cofactors D,E,G,C and Tubulin complex -- TBCC N Terminus Bound to Tubulin | | Authors: | Taheri, A., Al-bassam, J. | | Deposition date: | 2024-11-17 |
|
| PDBID: | 9edf | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Streptavidin-S112C-L124F bound to Cu(II)dpea cofactor | | Authors: | Minnetian, N.M., Borovik, A.S., Follmer, A.H. | | Deposition date: | 2024-11-17 |
|
| PDBID: | 9edg | | Status: | HPUB -- hold until publication | | Title: | Streptavidin-WT bound to Cu(II)dpea cofactor | | Authors: | Minnetian, N.M., Borovik, A.S., Follmer, A.H. | | Deposition date: | 2024-11-17 |
|
| PDBID: | 9edh | | Status: | HPUB -- hold until publication | | Title: | Streptavidin-S112C-T114F bound to Cu(II)dpea cofactor | | Authors: | Minnetian, N.M., Borovik, A.S., Follmer, A.H. | | Deposition date: | 2024-11-17 |
|
