| PDBID: | 9fcv | | Status: | PROC -- to be processed | | Title: | Cas nuclease-CRISPR (cr)RNA ribonucleoprotein (RNP) complex | | Authors: | Schmelz, S., Lukat, P., Blankenfeldt, W. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fda | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fcx | | Status: | HPUB -- hold until publication | | Title: | CysG(N-16)-H121N mutant in complex with SAH from Kitasatospora cystarginea | | Authors: | Kuttenlochner, W., Beller, P., Kaysser, L., Groll, M. | | Deposition date: | 2024-05-16 | | Sequence: | >Entity 1
GSTYDALRRQLIPSFDLLYGSAVSVVAMSVPATARILDLGAGTGLLGAALRERLPDAELLLQDRSQAMLEQARQRFADDDQVAIRVADHLDELPAGPFDAVVSALSINHLEHQDKQDLFTRIRKILRPGGIFVNVEQVLAPTSELEKMYDRQHEAHVLASDTPAEEWAAGRERMKHDIPIDVETQIQWLRDAGFTTADCLAKDWRFATYAGWNGS
|
|
| PDBID: | 9fcy | | Status: | HPUB -- hold until publication | | Title: | CysG(N-16)-R21K mutant in complex with SAH from Kitasatospora cystarginea | | Authors: | Kuttenlochner, W., Beller, P., Kaysser, L., Groll, M. | | Deposition date: | 2024-05-16 | | Sequence: | >Entity 1
GSTYDALKRQLIPSFDLLYGSAVSVVAMSVPATARILDLGAGTGLLGAALRERLPDAELLLQDRSQAMLEQARQRFADDDQVAIRVADHLDELPAGPFDAVVSALSIHHLEHQDKQDLFTRIRKILRPGGIFVNVEQVLAPTSELEKMYDRQHEAHVLASDTPAEEWAAGRERMKHDIPIDVETQIQWLRDAGFTTADCLAKDWRFATYAGWNGS
|
|
| PDBID: | 9fd3 | | Status: | HPUB -- hold until publication | | Title: | CysG(N-16)-D190N mutant in complex with SAH from Kitasatospora cystarginea | | Authors: | Kuttenlochner, W., Beller, P., Kaysser, L., Groll, M. | | Deposition date: | 2024-05-16 | | Sequence: | >Entity 1
GSTYDALRRQLIPSFDLLYGSAVSVVAMSVPATARILDLGAGTGLLGAALRERLPDAELLLQDRSQAMLEQARQRFADDDQVAIRVADHLDELPAGPFDAVVSALSIHHLEHQDKQDLFTRIRKILRPGGIFVNVEQVLAPTSELEKMYDRQHEAHVLASDTPAEEWAAGRERMKHNIPIDVETQIQWLRDAGFTTADCLAKDWRFATYAGWNGS
|
|
| PDBID: | 9fdc | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fdf | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fd7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Re-engineered peroxygenase variant of 2-deoxy-D-ribose-5-phosphate aldolase in substrate-free state | | Authors: | Thunnissen, A.M.W.H., Zhou, H., Frietema, H.O.T., Poelarends, G.J. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fdb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Co-crystal structure of Galectin-3 with an inhibitor | | Authors: | Mac Sweeney, A. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 9fd8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Re-engineered peroxygenase variant of 2-deoxy-D-ribose-5-phosphate aldolase, Schiff-base complex with 4-chloro-cinnamaldehyde | | Authors: | Thunnissen, A.M.W.H., Zhou, H., Frietema, H.O.T., Poelarends, G.J. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8zk4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-15 |
|
| PDBID: | 8zjp | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Drimenyl diphosphate synthase SsDMS_Y505I&D303A from Streptomyces showdoensis in complex with farnesyl diphosphate (FPP) and Mg2+ | | Authors: | Pan, X.M., Dong, S.M., Dong, L.B. | | Deposition date: | 2024-05-15 |
|
| PDBID: | 8zjr | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of nucleosome-bound RFX5 complex | | Authors: | Xu, K., Zhang, Y., Yin, Y., Xue, W., Han, Y., Tian, Y. | | Deposition date: | 2024-05-15 |
|
| PDBID: | 8zjn | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of nucleosome-bound RFX5 complex -asterisk | | Authors: | Xu, K., Zhang, Y., Yin, Y., Xue, W., Han, Y., Tian, Y. | | Deposition date: | 2024-05-15 |
|
| PDBID: | 8zjs | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of hexasome-bound RFX5 complex | | Authors: | Xu, K., Zhang, Y., Yin, Y., Xue, W., Han, Y., Tian, Y. | | Deposition date: | 2024-05-15 |
|
| PDBID: | 8zjo | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of dinucleosome-bound RFX5 complex | | Authors: | Xu, K., Zhang, Y., Yin, Y., Xue, W., Han, Y., Tian, Y. | | Deposition date: | 2024-05-15 |
|
| PDBID: | 8zjq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of dinucleosome-bound RFX5 complex | | Authors: | Xu, K., Zhang, Y., Yin, Y., Xue, W., Han, Y., Tian, Y. | | Deposition date: | 2024-05-15 |
|
| PDBID: | 8zjj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-15 |
|
| PDBID: | 8zjk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-15 |
|
| PDBID: | 8zjl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-15 |
|
| PDBID: | 8zjm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-15 |
|
| PDBID: | 8zjw | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-15 |
|
| PDBID: | 8zk2 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-15 |
|
| PDBID: | 8zka | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of the Decarboxylase KDC4427 in complex with phenylpyruvic acid intermediate | | Authors: | Dong, S., Liu, L., Zhang, H. | | Deposition date: | 2024-05-15 | | Release date: | 2025-05-15 |
|
| PDBID: | 8zk5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of dinucleosome | | Authors: | Xu, K., Zhang, Y., Yin, Y., Xue, W., Han, Y., Tian, Y. | | Deposition date: | 2024-05-15 |
|
