PDBID: | 8s42 | Status: | HPUB -- hold until publication | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 80 (1124898) | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | Deposition date: | 2024-02-21 |
|
PDBID: | 8s4d | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-02-21 |
|
PDBID: | 8s4l | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8s4f | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 | Sequence: | >Entity 1 MSPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
PDBID: | 8s4j | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8s4m | Status: | HPUB -- hold until publication | Title: | Crystal structure of Mycobacterium tuberculosis cytochrome P450 CYP125 in complex with an inhibitor | Authors: | Snee, M., Kavanagh, M., Levy, C. | Deposition date: | 2024-02-21 |
|
PDBID: | 8s4n | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8s4i | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8s43 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-02-21 |
|
PDBID: | 8s44 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8s4o | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8s4h | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8s4e | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8s4k | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8w2y | Status: | HPUB -- hold until publication | Title: | Structure and interactions of HIV-1 gp41 CHR-NHR reverse hairpin constructs reveal molecular determinants of antiviral activity | Authors: | McAndrew, R.P., Ralston, C.Y., Gochin, M. | Deposition date: | 2024-02-21 |
|
PDBID: | 8w32 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8w2u | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of human tankyrase 2 SAM-PARP filament -apo state (consensus map). | Authors: | Malone, B.F., Zimmerman, J.L., Dow, L.E., Hite, R.K. | Deposition date: | 2024-02-21 |
|
PDBID: | 8w2t | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of human tankyrase 2 SAM-PARP filament - apo state (focused refinement map). | Authors: | Malone, B.F., Zimmerman, J.L., Dow, L.E., Hite, R.K. | Deposition date: | 2024-02-21 |
|
PDBID: | 8w2s | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8w2q | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8w30 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8w2x | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8w2z | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-21 |
|
PDBID: | 8w36 | Status: | HPUB -- hold until publication | Title: | rabbit actin in the absence of potassium | Authors: | Volkmann, N. | Deposition date: | 2024-02-21 |
|
PDBID: | 8ydi | Status: | AUTH -- processed, waiting for author review and approval | Title: | E.coli transcription translation coupling complex in TTC-P state 1 (subclass 2) containing mRNA with 39-mer spacer, NusG, NusA, fMet-tRNA(iMet), Phe-tRNA(Phe), and viomycin | Authors: | Zhang, J., Lu, G., Wang, C., Lin, J. | Deposition date: | 2024-02-20 |
|