| PDBID: | 9olw | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9r6s | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9r6t | | Status: | HPUB -- hold until publication | | Title: | Prefusion stabilized spike glycoprotein of equine coronavirus. | | Authors: | Melchers, J.M., Hulswit, R.J.G., Hurdiss, D.L. | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9r6z | | Status: | HPUB -- hold until publication | | Title: | Cubic state of the F420-reducing hydrogenase from Methanothermococcus thermolithotrophicus | | Authors: | Jespersen, M., Lemaire, O.N., Wagner, T. | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9r6w | | Status: | HPUB -- hold until publication | | Title: | CHAP domain of Pneumococcal Endopeptidase PcsB | | Authors: | Briggs, N.S., Roper, D.I. | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9r6o | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9r71 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of E. coli Adenylate kinase E114A mutant in complex with inhibitor Ap5a. | | Authors: | Mattsson, J., Rogne, P., Wolf-Watz, M., Sauer-Eriksson, A.E. | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9r6u | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9r6p | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9r72 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Odinarchaeota Adenylate kinase (OdinAK) S74G mutant | | Authors: | Rodriguez Buitrago, J.A., Schierholz, L., Mattsson, J., Wolf-Watz, M., Sauer-Eriksson, A.E. | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9r6m | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of C14S mutant of triosephosphate isomerase from Chamydomonas reinhardtii | | Authors: | Fermani, S., Fanti, S., Gabellini, G., Zaffagnini, M., Meloni, M., Peppi, G.M.E. | | Deposition date: | 2025-05-13 | | Sequence: | >Entity 1
ASSAKFFVGGNWKSNGSVANVAKLVDELNAGTIPRGVDVVVAPPFIYIDYVMQHLDRDKYQLSAQNAWIGGNGAFTGEVSAEQLTDFGVPWVILGHSERRSLFGESNEVVAKKTSHALAAGLGVIACIGETLEQRNSGSVFKVLDAQMDALVDEVKDWTKVVLAYEPVWAIGTGVVASPEQAQEVHAYLRQYCAKKLGAAVADKLRIIYGGSVSDTNCKDLSKQEDIDGFLVGGASLKGAAFVTICNAAGPKAKP
|
|
| PDBID: | 9r6v | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9r6r | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9r6l | | Status: | HPUB -- hold until publication | | Title: | Map of neurofibromin homotetramer. | | Authors: | Shutian, S. | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9r6n | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9r6x | | Status: | HPUB -- hold until publication | | Title: | Map of neurofibromin homotetramer with D2 symmetry. | | Authors: | Shutian, S. | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9r75 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9r6q | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-13 |
|
| PDBID: | 9uwh | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9uw5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9uw8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9uw6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9uw7 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9uwa | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Pictet-Spenglerase AsKslB | | Authors: | Qia, Z., Yang, X.N., Teng, Y.B. | | Deposition date: | 2025-05-12 |
|
| PDBID: | 9uwg | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-05-12 |
|
