| PDBID: | 9lvr | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9lvn | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of phospholipase D SkPLD (Streptomyces klenkii) | | Authors: | Hu, R.K., Feng, C.H. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9lvp | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9lvt | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9lvv | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9lvw | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9ibd | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9ibc | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9ibm | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9ibb | | Status: | HPUB -- hold until publication | | Title: | Rhombohedral crystalline form of human insulin complexed with m-cresol | | Authors: | Papaefthymiou, C., Nanao, M.H., Margiolaki, I., Kontarinis, A., Kafetzi, S., Konstantopoulos, M., Koutoulas, D. | | Deposition date: | 2025-02-12 | | Sequence: | >Entity 1
GIVEQCCTSICSLYQLENYCN
>Entity 2
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
|
|
| PDBID: | 9ibe | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9ibi | | Status: | HPUB -- hold until publication | | Title: | Solution NMR study of the titin I-band IgI domain I82 reveals conformational dynamics | | Authors: | Pfuhl, M., Gage, M. | | Deposition date: | 2025-02-12 | | Sequence: | >Entity 1
GIDPFTIEPAWERHLQDVTLKEGQTCTMTCQFSVPNVKSEWFRNGRVLKPQGRVKTEVEHKVHKLTIADVRAEDQGQYTCKHEDLETSAELRIEKGELRSGC
|
|
| PDBID: | 9ibl | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9ibf | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-02-12 | | Release date: | 2026-02-12 |
|
| PDBID: | 9iba | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9ibh | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Salmonella typhimurium polynucleotide phosphorylase in complex with recognition site of RNase E | | Authors: | Paris, G., Luisi, B.F. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9ibk | | Status: | HPUB -- hold until publication | | Title: | Solution NMR study of the titin I-band IgI domain I82 reveals conformational dynamics | | Authors: | Pfuhl, M., Gage, M. | | Deposition date: | 2025-02-12 | | Sequence: | >Entity 1
GIDPFTIEPAWERHLQDVTLKEGQTCTMTCQFSVPNVKSEWFRNGRVLKPQGRVKTEVEHKVHKLTIADVRAEDQGQYTCKHEDLETSAELRIEKGELRSGC
|
|
| PDBID: | 9ibn | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the peptidyl-prolyl isomerase (PPIase) from E. faecium | | Authors: | Napolitano, V., Kramarska, E., Berisio, R. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9nau | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9nal | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of ternary complex of human phosphoribosylglycinamidine synthase with the intermediate (iminophosphate) and ADP bound at the synthase site. | | Authors: | Sharma, N., French, J.B. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9nak | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to tRNA | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9nam | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to Mango in the absence of ligand | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9nap | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to Mango in the presence of TO1-biotin | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9nan | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of human ROCK2 in complex with inhibitor | | Authors: | Depetris, R.S. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9naq | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-12 |
|
