PDBID: | 8rl9 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-02 |
|
PDBID: | 8rla | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-02 |
|
PDBID: | 8rlb | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-02 |
|
PDBID: | 8rlc | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-02 |
|
PDBID: | 8rld | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-02 |
|
PDBID: | 8rle | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-02 |
|
PDBID: | 8rl1 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-02 |
|
PDBID: | 8rl4 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-02 |
|
PDBID: | 8rkz | Status: | HPUB -- hold until publication | Title: | Crystal structure of a cysteine hydrolase from Phytophthora infestans | Authors: | Altegoer, F., Weiland, P., Bange, G. | Deposition date: | 2024-01-02 |
|
PDBID: | 8rl3 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-02 |
|
PDBID: | 8rl2 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-02 |
|
PDBID: | 8rl0 | Status: | HPUB -- hold until publication | Title: | Crystal structure of a cysteine hydrolase from Ustilago maydis | Authors: | Altegoer, F., Christ, M., Bange, G. | Deposition date: | 2024-01-02 |
|
PDBID: | 8vi1 | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-01-02 | Release date: | 2025-01-02 |
|
PDBID: | 8vhh | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-02 |
|
PDBID: | 8vhs | Status: | AUTH -- processed, waiting for author review and approval | Title: | X-ray Structure of a De Novo Designed Self Assembled Peptide Tetramer Featuring a Cu(His)4(H2O) Coordination Motif | Authors: | Chakraborty, S., Mitra, S., Prakash, D., Prasad, P. | Deposition date: | 2024-01-02 |
|
PDBID: | 8vhj | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-02 |
|
PDBID: | 8vhk | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-02 |
|
PDBID: | 8vhn | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-02 |
|
PDBID: | 8vho | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-02 |
|
PDBID: | 8vhv | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-02 |
|
PDBID: | 8vhw | Status: | HPUB -- hold until publication | Title: | Neutron Structure of Peroxide-Soaked Trp161Phe MnSOD | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Lutz, W.E., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | Deposition date: | 2024-01-02 | Sequence: | >Entity 1 MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVFEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
PDBID: | 8vhz | Status: | HPUB -- hold until publication | Title: | Cryo EM structure of a soybean CesA1 homotrimer | Authors: | Ho, R., Palliniti, P., Zimmer, J. | Deposition date: | 2024-01-02 |
|
PDBID: | 8vi0 | Status: | HPUB -- hold until publication | Title: | Cryo EM structure of a soybean CesA6 homotrimer | Authors: | Ho, R., Palliniti, P., Zimmer, J. | Deposition date: | 2024-01-02 |
|
PDBID: | 8vhy | Status: | HPUB -- hold until publication | Title: | Neutron Structure of Reduced Trp161Phe MnSOD | Authors: | Azadmanesh, J., Slobodnik, K., Struble, L.R., Lutz, W.E., Coates, L., Weiss, K.L., Myles, D.A.A., Kroll, T., Borgstahl, G.E.O. | Deposition date: | 2024-01-02 | Sequence: | >Entity 1 MKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLLGIDVFEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
|
|
PDBID: | 8vhp | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-02 |
|