PDBID: | 9g2q | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-11 |
|
PDBID: | 9g2j | Status: | HPUB -- hold until publication | Title: | Thaumatin structure determined using SoS chip at ID29 (serial crystallography) | Authors: | Doak, R.B., Shoeman, R.L., Gorel, A., Barends, T.R.M., Schlichting, I. | Deposition date: | 2024-07-11 |
|
PDBID: | 9g39 | Status: | HPUB -- hold until publication | Title: | Crystal Structure of the artificial protein METP in complex with cadmium ion at different temperature | Authors: | Di Costanzo, L., La Gatta, S., Chino, M. | Deposition date: | 2024-07-11 |
|
PDBID: | 9ipx | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-11 |
|
PDBID: | 9ips | Status: | HPUB -- hold until publication | Title: | Crystal structure of KRM1 in complex with shark VNAR-3108 | Authors: | Cui, Y.Z., Li, H.M., Tong, J.Y., Tong, Z., Qi, J.X., Gao, G.F. | Deposition date: | 2024-07-11 |
|
PDBID: | 9ipt | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-11 |
|
PDBID: | 9ipr | Status: | HPUB -- hold until publication | Title: | Crystal structure of CTB10-M1 | Authors: | Fu, K., Rao, Y.J. | Deposition date: | 2024-07-11 |
|
PDBID: | 9ipq | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-11 |
|
PDBID: | 9ipn | Status: | HPUB -- hold until publication | Title: | Hemichannel sub-structure of Cx36/GJD2 gap junction intercellular channel (FN conformation) in soybean polar lipid nanodiscs, treated with a 10-fold molar excess of carbenoxolone and incubated shortly | Authors: | Jang, H.S. | Deposition date: | 2024-07-11 |
|
PDBID: | 9ipp | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of MERS main protease in complex with carmofur | Authors: | Guo, L., Zhou, X.L., Zeng, P., Li, W.W., Zhang, J., Li, J. | Deposition date: | 2024-07-11 | Release date: | 2025-07-11 |
|
PDBID: | 9ipo | Status: | HPUB -- hold until publication | Title: | Hemichannel sub-structure of Cx36/GJD2 gap junction intercellular channel (FN conformation) in soybean polar lipid nanodiscs, treated with a 10-fold molar excess of carbenoxolone | Authors: | Jang, H.S. | Deposition date: | 2024-07-11 |
|
PDBID: | 9ipm | Status: | HPUB -- hold until publication | Title: | Hemichannel sub-structure of Cx36/GJD2 gap junction intercellular channel (FN conformation) in soybean polar lipid nanodiscs, treated with a 20-fold molar excess of carbenoxolone | Authors: | Jang, H.S. | Deposition date: | 2024-07-11 |
|
PDBID: | 9ipw | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of VHL-EloB-EloC in complex with a fragment compound 7HC_5(D3) | Authors: | Lee, B.I., Kim, Y. | Deposition date: | 2024-07-11 | Release date: | 2025-01-11 |
|
PDBID: | 9ipv | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-07-11 |
|
PDBID: | 9clk | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-11 |
|
PDBID: | 9clj | Status: | HPUB -- hold until publication | Title: | HIV-2 CA T=1 Icosahedron; assembled via lipid templating | Authors: | Cook, M., Freniere, C., Xiong, Y. | Deposition date: | 2024-07-11 | Sequence: | >Entity 1 PVQQTGGGNYIHVPLSPRTLNAWVKLVEDKKFGAEVVPGFQALSEGCTPYDINQMLNCVGDHQAAMQIIREIINDEAADWDAQHPIPGPLPAGQLRDPRGSDIAGTTSTVEEQIQWMYRPQNPVPVGNIYRRWIQIGLQKCVRMYNPTNILDVKQGPKEPFQSYVDRFYKSLRAEQTDPAVKNWMTQTLLIQNANPDCKLVLKGLGMNPTLEEMLTACQGVGGPGQKARLMGSSHHHHHH
|
|
PDBID: | 9cli | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM model derived from localized reconstruction of human adenovirus (Ad5)-hexon-FX complex at 3.6A resolution | Authors: | Reddy, V.S., Ma, O.X. | Deposition date: | 2024-07-11 |
|
PDBID: | 9clf | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-11 |
|
PDBID: | 9clg | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-11 |
|
PDBID: | 9clh | Status: | HPUB -- hold until publication | Title: | X-ray diffraction structure of the apo form of papain | Authors: | Vlahakis, N.W., Rodriguez, J.A. | Deposition date: | 2024-07-11 |
|
PDBID: | 9clo | Status: | HPUB -- hold until publication | Title: | DosP R97A with c-di-GMP | Authors: | Kumar, P., Kober, D.L. | Deposition date: | 2024-07-11 |
|
PDBID: | 9cln | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM model derived from localized reconstruction of human adenovirus 5 (Ad5)-hexon-FII complex at 3.9A resolution | Authors: | Reddy, V.S., Ma, O.X. | Deposition date: | 2024-07-11 |
|
PDBID: | 9clm | Status: | AUTH -- processed, waiting for author review and approval | Title: | Transferrin Binding Protein A in complex with transferrin binding protein B and two molecules of transferrin | Authors: | Dubey, S., Noinaj, N. | Deposition date: | 2024-07-11 |
|
PDBID: | 9cll | Status: | HPUB -- hold until publication | Title: | Plasmodium falciparum tyrosyl-tRNA synthetase in complex with ML471-Tyr | Authors: | Tai, C.W., Dogovski, C., Xie, S.C., Tilley, L., Griffin, M.D.W. | Deposition date: | 2024-07-11 |
|
PDBID: | 9cle | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-11 |
|