PDBID: | 9lpn | Status: | HOLD -- hold until a certain date | Deposition date: | 2025-01-25 | Release date: | 2026-01-25 |
|
PDBID: | 9lpo | Status: | HOLD -- hold until a certain date | Deposition date: | 2025-01-25 | Release date: | 2026-01-25 |
|
PDBID: | 9lpp | Status: | HOLD -- hold until a certain date | Deposition date: | 2025-01-25 | Release date: | 2026-01-25 |
|
PDBID: | 9lpq | Status: | HOLD -- hold until a certain date | Deposition date: | 2025-01-25 | Release date: | 2026-01-25 |
|
PDBID: | 9lps | Status: | HOLD -- hold until a certain date | Deposition date: | 2025-01-25 | Release date: | 2026-01-25 |
|
PDBID: | 9i4k | Status: | HPUB -- hold until publication | Title: | Galectin-1 in Complex with Methyl 6-fluoro-N-acetyllactosaminide | Authors: | Pachl, P. | Deposition date: | 2025-01-25 | Sequence: | >Entity 1 SMACGLVASNLNLKPGE(CME)LRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVCNSKDGGAWGTEQREAVFPFQPGSVAEV(CME)ITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAADGDFKIK(CME)VAFD
|
|
PDBID: | 9i4l | Status: | HPUB -- hold until publication | Title: | Galectin-1 in Complex with Methyl 2''-fluoro-N-acetyllactosaminide | Authors: | Pachl, P. | Deposition date: | 2025-01-25 |
|
PDBID: | 9i4m | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Galectin-1 in Complex with Methyl 3''-fluoro-N-acetyllactosaminide | Authors: | Pachl, P. | Deposition date: | 2025-01-25 |
|
PDBID: | 9i4n | Status: | HPUB -- hold until publication | Title: | Galectin-3 in Complex with Methyl 6-fluoro-N-acetyllactosaminide | Authors: | Pachl, P. | Deposition date: | 2025-01-25 |
|
PDBID: | 9i4o | Status: | HPUB -- hold until publication | Title: | Galectin-3 in Complex with Methyl 2''-fluoro-N-acetyllactosaminide | Authors: | Pachl, P. | Deposition date: | 2025-01-25 |
|
PDBID: | 9i4p | Status: | HPUB -- hold until publication | Title: | Galectin-3 in Complex with Methyl 3''-fluoro-N-acetyllactosaminide | Authors: | Pachl, P. | Deposition date: | 2025-01-25 |
|
PDBID: | 9i4q | Status: | HPUB -- hold until publication | Title: | SSX structure of dye-type peroxidase DtpB from Streptomyces lividans | Authors: | Smyth, P., Williams, L.J., Hough, M.A., Worrall, J.A.R., Owen, R.L. | Deposition date: | 2025-01-25 |
|
PDBID: | 9n1b | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-25 |
|
PDBID: | 9n1c | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-25 |
|
PDBID: | 9n1d | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-25 |
|
PDBID: | 9n1e | Status: | HPUB -- hold until publication | Deposition date: | 2025-01-25 |
|
PDBID: | 7hzv | Status: | AUTH -- processed, waiting for author review and approval | Title: | PanDDA analysis group deposition -- Crystal structure of Enterococcus faecium VatD in complex with ZINC000000438614 | Authors: | Asthana, P., Fraser, J.S. | Deposition date: | 2025-01-25 |
|
PDBID: | 7hzw | Status: | AUTH -- processed, waiting for author review and approval | Title: | PanDDA analysis group deposition -- Crystal structure of Enterococcus faecium VatD in complex with ZINC000000039994 | Authors: | Asthana, P., Fraser, J.S. | Deposition date: | 2025-01-25 |
|
PDBID: | 7hzx | Status: | AUTH -- processed, waiting for author review and approval | Title: | PanDDA analysis group deposition -- Crystal structure of Enterococcus faecium VatD in complex with ZINC000000164888 | Authors: | Asthana, P., Fraser, J.S. | Deposition date: | 2025-01-25 |
|
PDBID: | 7hzy | Status: | AUTH -- processed, waiting for author review and approval | Title: | PanDDA analysis group deposition -- Crystal structure of Enterococcus faecium VatD in complex with ZINC000002977810 | Authors: | Asthana, P., Fraser, J.S. | Deposition date: | 2025-01-25 |
|
PDBID: | 7hzz | Status: | AUTH -- processed, waiting for author review and approval | Title: | PanDDA analysis group deposition -- Crystal structure of Enterococcus faecium VatD in complex with ZINC000000001712 | Authors: | Asthana, P., Fraser, J.S. | Deposition date: | 2025-01-25 |
|
PDBID: | 7i00 | Status: | AUTH -- processed, waiting for author review and approval | Title: | PanDDA analysis group deposition -- Crystal structure of Enterococcus faecium VatD in complex with ZINC000084843283 | Authors: | Asthana, P., Fraser, J.S. | Deposition date: | 2025-01-25 |
|
PDBID: | 7i01 | Status: | AUTH -- processed, waiting for author review and approval | Title: | PanDDA analysis group deposition -- Crystal structure of Enterococcus faecium VatD in complex with ZINC000000388593 | Authors: | Asthana, P., Fraser, J.S. | Deposition date: | 2025-01-25 |
|
PDBID: | 7i02 | Status: | AUTH -- processed, waiting for author review and approval | Title: | PanDDA analysis group deposition -- Crystal structure of Enterococcus faecium VatD in complex with ZINC000000873830 | Authors: | Asthana, P., Fraser, J.S. | Deposition date: | 2025-01-25 |
|
PDBID: | 7i03 | Status: | AUTH -- processed, waiting for author review and approval | Title: | PanDDA analysis group deposition -- Crystal structure of Enterococcus faecium VatD in complex with ZINC000027858187 | Authors: | Asthana, P., Fraser, J.S. | Deposition date: | 2025-01-25 |
|