| PDBID: | 8x9r | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8x9v | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Xanthomonas oryzae pv. oryzae NADH-quinone oxidoreductase subunits NuoE and NuoF | | Authors: | Li, L., Ran, T., Wang, W., Zhang, F. | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8rah | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8rag | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8ral | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8ray | | Status: | HPUB -- hold until publication | | Title: | ParA in complex with ATP | | Authors: | Mais, C.-N., Bange, G. | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8ram | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8rap | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of Sen1-ADP.BeF3 bound RNA Polymerase II pre-termination complex | | Authors: | Rengachari, S., Lidscreiber, M., Cramer, P. | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8ran | | Status: | HPUB -- hold until publication | | Title: | Structure of Sen1-RNA complex | | Authors: | Rengachari, S., Lidscreiber, M., Cramer, P. | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8rao | | Status: | HPUB -- hold until publication | | Title: | Structure of Sen1-ADP.BeF3-RNA complex | | Authors: | Rengachari, S., Lidscreiber, M., Cramer, P. | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8rau | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8rav | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8raw | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8rax | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8raz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8rb2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8rb0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8rb1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8raq | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8rar | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of chimeric human carbonic anhydrase IX with N-butyl-4-chloro-2-(cyclohexylsulfanyl)-5-sulfamoylbenzamide | | Authors: | Manakova, E.N., Smirnov, A., Paketuryte, V., Grazulis, S. | | Deposition date: | 2023-12-01 | | Sequence: | >Entity 1
MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFQVEFDDSQDKAVLKGGPLDGTYRLLQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDVGKALQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLAECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
| PDBID: | 8v67 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-12-01 |
|
| PDBID: | 8v6a | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-12-01 | | Release date: | 2024-12-01 |
|
| PDBID: | 8v6d | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-12-01 | | Release date: | 2024-12-01 |
|
| PDBID: | 8v6f | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-12-01 | | Release date: | 2024-12-01 |
|
| PDBID: | 8v6c | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-12-01 | | Release date: | 2024-12-01 |
|
