| PDBID: | 9ibu | | Status: | HPUB -- hold until publication | | Title: | THE COLLAGEN REPEATING SEQUENCE (PRO-PRO-GLY)10 AT HIGH RESOLUTION | | Authors: | Prange, T., Girard, E., Colloc''h, N., Dhaussy, A.C. | | Deposition date: | 2025-02-13 | | Sequence: | >Entity 1
PPGPPGPPGPPGPPGPPGPPGPPGPPGPPGPPG
>Entity 2
PPGPPGPPGPPGPPGPPGPPGPPGPPGPPG
|
|
| PDBID: | 9lvz | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-13 |
|
| PDBID: | 9lw0 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cytochrome P450PL2 from Parvibaculum lavamentivorans DS-1 | | Authors: | Cui, H.B. | | Deposition date: | 2025-02-13 |
|
| PDBID: | 9lw5 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of dopamine bound mut-beta2-Adrenergic Receptor-miniGs-Nb35-scFv16 complex | | Authors: | Zhang, X., Gao, K., Liu, X. | | Deposition date: | 2025-02-13 |
|
| PDBID: | 9lw4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-13 |
|
| PDBID: | 9lw1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | TMEM164-substrate | | Authors: | Zhang, M.F. | | Deposition date: | 2025-02-13 | | Release date: | 2026-02-13 |
|
| PDBID: | 9lw3 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | TMEM164-substrate | | Authors: | Zhang, M.F. | | Deposition date: | 2025-02-13 | | Release date: | 2026-02-13 |
|
| PDBID: | 9nb0 | | Status: | HPUB -- hold until publication | | Title: | Isoreticular, Porous co-crystal of Replication Initiator Protein REPE54 and asymmetrical expanded duplex (31mer) containing the cognate REPE54 sequence and additional expansion sequence | | Authors: | Shields, E.T., Snow, C.D. | | Deposition date: | 2025-02-13 |
|
| PDBID: | 9naz | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-13 |
|
| PDBID: | 9nb1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-13 |
|
| PDBID: | 9nb3 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of quaternary complex of human phosphoribosylglycinamidine synthase with thioester intermediate bound (at glutaminase site) and AMPPNP and FGAR (at synthase site). | | Authors: | Sharma, N., French, J.B. | | Deposition date: | 2025-02-13 |
|
| PDBID: | 9nbc | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to 8-oxoguanine riboswitch aptamer | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-13 |
|
| PDBID: | 9nbe | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-13 |
|
| PDBID: | 9nbh | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to 8-oxoguanine riboswitch aptamer core only | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-13 |
|
| PDBID: | 9ibd | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9ibc | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9ibm | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9ibb | | Status: | HPUB -- hold until publication | | Title: | Rhombohedral crystalline form of human insulin complexed with m-cresol | | Authors: | Papaefthymiou, C., Nanao, M.H., Margiolaki, I., Kontarinis, A., Kafetzi, S., Konstantopoulos, M., Koutoulas, D. | | Deposition date: | 2025-02-12 | | Sequence: | >Entity 1
GIVEQCCTSICSLYQLENYCN
>Entity 2
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
|
|
| PDBID: | 9ibe | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9ibi | | Status: | HPUB -- hold until publication | | Title: | Solution NMR study of the titin I-band IgI domain I82 reveals conformational dynamics | | Authors: | Pfuhl, M., Gage, M. | | Deposition date: | 2025-02-12 | | Sequence: | >Entity 1
GIDPFTIEPAWERHLQDVTLKEGQTCTMTCQFSVPNVKSEWFRNGRVLKPQGRVKTEVEHKVHKLTIADVRAEDQGQYTCKHEDLETSAELRIEKGELRSGC
|
|
| PDBID: | 9ibl | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9ibf | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-02-12 | | Release date: | 2026-02-12 |
|
| PDBID: | 9iba | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9ibh | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Salmonella typhimurium polynucleotide phosphorylase in complex with recognition site of RNase E | | Authors: | Paris, G., Luisi, B.F. | | Deposition date: | 2025-02-12 |
|
| PDBID: | 9ibk | | Status: | HPUB -- hold until publication | | Title: | Solution NMR study of the titin I-band IgI domain I82 reveals conformational dynamics | | Authors: | Pfuhl, M., Gage, M. | | Deposition date: | 2025-02-12 | | Sequence: | >Entity 1
GIDPFTIEPAWERHLQDVTLKEGQTCTMTCQFSVPNVKSEWFRNGRVLKPQGRVKTEVEHKVHKLTIADVRAEDQGQYTCKHEDLETSAELRIEKGELRSGC
|
|
