PDBID: | 9kqs | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-11-26 |
|
PDBID: | 9kqp | Status: | HPUB -- hold until publication | Title: | PSI-LHCI supercomplex binding with 10 Lhcas from C. subellipsoidea | Authors: | Tsai, P.-C., Kato, K., Shen, J.-R., Akita, F. | Deposition date: | 2024-11-26 |
|
PDBID: | 9kqq | Status: | HPUB -- hold until publication | Title: | PSI-LHCI supercomplex binding with 8 Lhcas from C. subellipsoidea | Authors: | Tsai, P.-C., Kato, K., Shen, J.-R., Akita, F. | Deposition date: | 2024-11-26 |
|
PDBID: | 9kqr | Status: | HPUB -- hold until publication | Title: | Cryo-EM Structure of Mature Semliki Forest Virus | Authors: | Jia, X., Li, S., Zhang, Q., He, J. | Deposition date: | 2024-11-26 |
|
PDBID: | 9kqm | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-11-26 |
|
PDBID: | 9kqt | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-11-26 | Release date: | 2025-11-26 |
|
PDBID: | 9kqn | Status: | AUTH -- processed, waiting for author review and approval | Title: | Hsp90-Cdc37-PINK1 complex | Authors: | Tian, X.Y., Su, J.Y. | Deposition date: | 2024-11-26 |
|
PDBID: | 9kqk | Status: | HPUB -- hold until publication | Title: | Crystal structure of HSA in complex with AmpHecy | Authors: | Chen, X., Shi, M.W., Ge, Y.H., Fang, B., Li, L. | Deposition date: | 2024-11-26 |
|
PDBID: | 9kqi | Status: | HPUB -- hold until publication | Deposition date: | 2024-11-26 |
|
PDBID: | 9kqj | Status: | HPUB -- hold until publication | Deposition date: | 2024-11-26 |
|
PDBID: | 9kqo | Status: | PROC -- to be processed | Title: | cryo-EM structure of RNF20/RNF40-RAD6A-Ub in complex with H2BS112GlcNAc nucleosome | Authors: | Deng, Z.H., Ai, H.S., Liu, L. | Deposition date: | 2024-11-26 |
|
PDBID: | 9hid | Status: | HPUB -- hold until publication | Deposition date: | 2024-11-25 |
|
PDBID: | 9hie | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-11-25 |
|
PDBID: | 9hi9 | Status: | HPUB -- hold until publication | Deposition date: | 2024-11-25 |
|
PDBID: | 9hi8 | Status: | HPUB -- hold until publication | Deposition date: | 2024-11-25 |
|
PDBID: | 9hia | Status: | HPUB -- hold until publication | Title: | K115 acetylated human muscle pyruvate kinase, isoform M2 (PKM2), in complex with FBP | Authors: | Pavlenko, D., Nudelman, H., Shahar, A., Arbely, E. | Deposition date: | 2024-11-25 |
|
PDBID: | 9hib | Status: | HPUB -- hold until publication | Title: | K115 acetylated human muscle pyruvate kinase, isoform M2 (PKM2) | Authors: | Pavlenko, D., Nudelman, H., Shahar, A., Arbely, E. | Deposition date: | 2024-11-25 |
|
PDBID: | 9hic | Status: | AUTH -- processed, waiting for author review and approval | Title: | K166 acetylated human muscle pyruvate kinase, isoform M2 (PKM2), in complex with FBP | Authors: | Pavlenko, D., Nudelman, H., Shahar, A., Arbely, E. | Deposition date: | 2024-11-25 |
|
PDBID: | 9eie | Status: | HOLD -- hold until a certain date | Title: | Trypanosomatid-specific protein of unknown function | Authors: | Merritt, E.A., Structural Genomics of Pathogenic Protozoa Consortium (SGPP) | Deposition date: | 2024-11-25 | Release date: | 2025-11-25 | Sequence: | >Entity 1 GPGSMEMSRSSDTFSASRNRVRADEINDEEDHADAAYVEKHNLQCLFSEMAEQLSEKDPKTEQEAERILLEFLTHRKAERDRAALRLQFSHSFEVNLDNGRKIMRLQLGQETSTLQLEQKGRVLKMDEAFSISLEQTEELTEMFYELGRFVVDGTKGEQGGFISIDERDVYLLAAGRECAEAGDELFNLAMLFSMDRGKKSEQTSGEA
|
|
PDBID: | 9ehu | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-11-25 |
|
PDBID: | 9ei7 | Status: | HPUB -- hold until publication | Deposition date: | 2024-11-25 |
|
PDBID: | 9ei6 | Status: | HPUB -- hold until publication | Deposition date: | 2024-11-25 |
|
PDBID: | 9ei5 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-11-25 |
|
PDBID: | 9ehz | Status: | HPUB -- hold until publication | Deposition date: | 2024-11-25 |
|
PDBID: | 9ehy | Status: | HPUB -- hold until publication | Deposition date: | 2024-11-25 |
|