| PDBID: | 9eeo | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM model of E. coli aspartate transcarbamoylase in the R-state complexed with CP, succinate, CTP, and Mg2+ | | Authors: | Patterson, M.G., Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eep | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM model of E. coli aspartate transcarbamoylase in the R-state complexed with CP and succinate | | Authors: | Patterson, M.G., Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9ees | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM model of E. coli aspartate transcarbamoylase in an expanded state complexed with CP, ATP, GTP, and Mg2+ | | Authors: | Patterson, M.G., Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eeq | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM model of E. coli aspartate transcarbamoylase in the R-state complexed with CP, succinate, ATP, and Mg2+ | | Authors: | Patterson, M.G., Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eeu | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM model of E. coli aspartate transcarbamoylase in the T-state complexed with CP, ATP, and Mg2+ | | Authors: | Patterson, M.G., Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eer | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM model of E. coli aspartate transcarbamoylase in the R-state complexed with CP, succinate, ATP, GTP, and Mg2+ | | Authors: | Patterson, M.G., Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eeh | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of E. coli aspartate transcarbamoylase in the R-state complexed with PALA, ATP, GTP, and Mg2+ | | Authors: | Patterson, M.G., Bhatt, N., Pei, X., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eej | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of E. coli aspartate transcarbamoylase in the R-state complexed with CP, succinate, ATP, and Mg2+ | | Authors: | Patterson, M.G., Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9een | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM model of E. coli aspartate transcarbamoylase in the T-state complexed with CP, CTP, and Mg2+ | | Authors: | Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9ef8 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eef | | Status: | HPUB -- hold until publication | | Title: | Human Kv1.3 mutant - G427H | | Authors: | Selvakumar, P., Swartz, K.J. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9ef3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9ef1 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Drosophila melanogaster insulin receptor (dmIR) bound with one DILP1, asymmetric conformation | | Authors: | Bai, X.C. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9ef2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eed | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The Hanks-type kinase PknS from Xanthomonas citri bound to CHIR-124 | | Authors: | Lima, L.P., Alvarez-Martinez, C.E., Massirer, K.B., Counago, R.M. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eee | | Status: | HPUB -- hold until publication | | Title: | Room-temperature X-ray structure of HIV-1 protease in complex with GRL-10624A inhibitor | | Authors: | Kovalevsky, A., Gerlits, O., Ghosh, A. | | Deposition date: | 2024-11-19 | | Sequence: | >Entity 1
PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYDQIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF
|
|
| PDBID: | 9eeg | | Status: | HPUB -- hold until publication | | Title: | Room-temperature X-ray structure of HIV-1 protease in complex with GRL-11124A inhibitor | | Authors: | Kovalevsky, A., Gerlits, O., Ghosh, A. | | Deposition date: | 2024-11-19 | | Sequence: | >Entity 1
PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYDQIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF
|
|
| PDBID: | 9ef4 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Drosophila melanogaster insulin receptor (dmIR) bound with two DILP1, symmetric conformation | | Authors: | Bai, X.C. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9ef5 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Drosophila melanogaster insulin receptor (dmIR) bound with one DILP2, asymmetric conformation | | Authors: | Bai, X.C. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9ef9 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Drosophila melanogaster insulin receptor (dmIR) bound with three DILP5, asymmetric conformation | | Authors: | Bai, X.C. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eew | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eek | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eel | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM model of E. coli aspartate transcarbamoylase in the T-state complexed with CP, CTP, UTP, and Mg2+ | | Authors: | Miller, R.C., Ando, N. | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9eet | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-19 |
|
| PDBID: | 9ef6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-19 |
|
