| PDBID: | 9ne7 | | Status: | HPUB -- hold until publication | | Title: | Human polymerase epsilon bound to PCNA and DNA with an in-situ-generated mismatch in the Pol-backtracking state | | Authors: | Wang, F., He, Q., Li, H. | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9ne8 | | Status: | HPUB -- hold until publication | | Title: | Human polymerase epsilon bound to PCNA and DNA with an in-situ-generated mismatch in the mismatch-locking state | | Authors: | Wang, F., He, Q., Li, H. | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9ne9 | | Status: | HPUB -- hold until publication | | Title: | Human polymerase epsilon bound to PCNA and DNA with a pre-existing mismatch in the blocked conformation I | | Authors: | Wang, F., He, Q., Li, H. | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9nea | | Status: | HPUB -- hold until publication | | Title: | Human polymerase epsilon bound to PCNA and DNA with a pre-existing mismatch in the blocked conformation II | | Authors: | Wang, F., He, Q., Li, H. | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9nej | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9ndz | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9neb | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9ne0 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9ne4 | | Status: | HPUB -- hold until publication | | Title: | cryoEM structure of the A-chain of the human OGA-L Catalytic Dimer | | Authors: | Nyenhuis, S.B., Steenackers, A., Hinshaw, J.E., Hanover, J.A. | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9ne3 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | [1,8,10,P-2] Shifted tensegrity triangle with an (arm,center,arm) distribution of (1,8,10) base pairs, 1 nt sticky ends, and 5'' phosphates | | Authors: | Horvath, A., Vecchioni, S., Woloszyn, K., Ohayon, Y.P., Sha, R. | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9ne5 | | Status: | HPUB -- hold until publication | | Title: | cryoEM structure of the B-chain of the human OGA-L Catalytic Dimer | | Authors: | Nyenhuis, S.B., Steenackers, A., Hinshaw, J.E., Hanover, J.A. | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9nec | | Status: | HPUB -- hold until publication | | Title: | AcA-EI-shaker with free peptide conformation A | | Authors: | Tan, X., Swartz, K.J. | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9ned | | Status: | HPUB -- hold until publication | | Title: | AcA-EI-shaker with free peptide conformation B | | Authors: | Tan, X., Swartz, K.J. | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9nee | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9neh | | Status: | HPUB -- hold until publication | | Title: | The 1.48 Angstrom crystal structure of galactose oxidase variant with genetically incorporated Cl2-Tyr495 | | Authors: | Liu, A., Li, J., Graciano, A. | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9neg | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9nef | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9nei | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9ifr | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9lxk | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-02-18 | | Release date: | 2026-02-18 |
|
| PDBID: | 9lxh | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9lxi | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-18 | | Sequence: | >Entity 1
MAQTVGVIGTGLMGSALVNTLLKAGTKVTVWDGRKEATAGVVANGAKLASSFVELVNGNDVVISIVSSASIGANLFREHVSQLNLDGRYVANLSTAMPEDGEAFRDIIESNGGRFISAAISSYPDLIGGPYTAIQYAGKEEVWRAVEATFKPLAPEGTIYTGANLAVPPIVDAAMTGSFYAVSLAGFLEAAAYAKARGVSPSQLGDFADKMLDLVRYKVHKSIREIEANNFETIQATVDVYLDAVIQWRDALKDVGLRASHIAALADDLTVTRDAGYGSLGFTAQFLTASKVD
|
|
| PDBID: | 9lxj | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-18 | | Release date: | 2026-02-18 |
|
| PDBID: | 9lxn | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-02-18 | | Release date: | 2026-02-18 |
|
| PDBID: | 9lxo | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-02-18 | | Release date: | 2026-02-18 |
|
