| PDBID: | 9l5t | | Status: | PROC -- to be processed | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9l5s | | Status: | PROC -- to be processed | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9l5o | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the mutant Y549A of collagenase VhaC | | Authors: | Zhao, W.X. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9l52 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The ring expansion oxygenase SpoC in complex with Fe and stipitaldehyde | | Authors: | Liu, M., He, X. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9l5x | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Crystal structure of Klebsiella pneumoniae Enoyl-Acyl Carrier Protein Reductase (FabI) in complex with Triclosan | | Authors: | Biswas, S., Patra, A., Kushwaha, G.S., Suar, M. | | Deposition date: | 2024-12-23 | | Release date: | 2025-12-23 |
|
| PDBID: | 9l56 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Zea mays plastid-localized exonuclease 1 | | Authors: | Shi, G., Huang, X., Wu, Y., Zhang, Y. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9l62 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9l5y | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9l5u | | Status: | HPUB -- hold until publication | | Title: | Papain-like cysteine protease toxin/immunity pair | | Authors: | Chen, P.-P., Hsia, K.-C., Ting, S.-Y., Chen, Y.-C. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9l5w | | Status: | HPUB -- hold until publication | | Title: | FADD-DED filaments coordinate complex IIa assembly during TNF-induced apoptosis | | Authors: | Tan, Y.B., Luo, D. | | Deposition date: | 2024-12-23 |
|
| PDBID: | 9l61 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of BRD2 BD2 domain in complex with small molecule inhibitor Mivebresib ABBV-075 | | Authors: | Jwala, N., Vijayshankar, N., Thomas, A., NarasimhaRao, K. | | Deposition date: | 2024-12-23 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHSEQLKHCNGILKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPD
|
|
| PDBID: | 9mnk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-22 |
|
| PDBID: | 9mnl | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-12-22 |
|
| PDBID: | 9mnn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-12-22 |
|
| PDBID: | 9mnm | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-12-22 |
|
| PDBID: | 9hud | | Status: | HPUB -- hold until publication | | Title: | Alpha-1-antitrypsin in the cleaved conformation in complex with a conformationally nonselective Fab fragment | | Authors: | Irving, J.A., Aldobiyan, I.F. | | Deposition date: | 2024-12-22 |
|
| PDBID: | 9huf | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-12-22 |
|
| PDBID: | 9hug | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-12-22 |
|
| PDBID: | 9hue | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-12-22 |
|
| PDBID: | 9l55 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PEN1 catalyzes RNA primer removal during plastid DNA replication in maize | | Authors: | Shi, G. | | Deposition date: | 2024-12-22 |
|
| PDBID: | 9l54 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-12-22 | | Release date: | 2025-12-22 |
|
| PDBID: | 9mnj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of influenza H3N2 Victoria 2011 hemagglutinin bound with VRC35 Fab and MEDI8852 Fab | | Authors: | Cheng, J., Cale, E.M., Longo, N., Sutton, M.S., Lei, H., Huang, R., Morton, A.J., Lang, Z.C., Morano, N.C., Roark, R.S., Becker, J.E., Tsybovsky, Y., Li, N., Zhang, B., Du, H., Rubin, S., Shapiro, L., Pierson, T.C., Doria-Rose, N.A., Kwong, P.D., Zhou, T. | | Deposition date: | 2024-12-21 |
|
| PDBID: | 9mnh | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Angavokely virus (AngV) fusion (F) protein ectodomain in pre-fusion conformation | | Authors: | Lella, M., Acharya, P. | | Deposition date: | 2024-12-21 |
|
| PDBID: | 9mne | | Status: | PROC -- to be processed | | Title: | Crystal structure of enteropathogenic Escherichia coli EspC | | Authors: | Pilapitiya, A.U., Heras, B., Paxman, J.J. | | Deposition date: | 2024-12-21 |
|
| PDBID: | 9mni | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-12-21 | | Release date: | 2025-12-21 |
|
