| PDBID: | 9erc | | Status: | HPUB -- hold until publication | | Title: | Hydrogenase-2 Ni-Li state | | Authors: | Wong, K.L., Carr, S.B., Ash, P.A., Vincent, K.A. | | Deposition date: | 2024-03-22 |
|
| PDBID: | 9erh | | Status: | HPUB -- hold until publication | | Title: | Uhgb_MS mannoside synthase from an unknown human gut bacterium in complex with 1,2-beta-mannobiose | | Authors: | Cioci, G., Ladeveze, S., Potocki-Veronese, G. | | Deposition date: | 2024-03-22 |
|
| PDBID: | 9eqn | | Status: | HPUB -- hold until publication | | Title: | N-terminal domain of Infectious Bursal Disease Virus (IBDV) VP3 | | Authors: | Ferrero, D.S., Verdaguer, N. | | Deposition date: | 2024-03-22 |
|
| PDBID: | 9eqo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-22 |
|
| PDBID: | 9eqp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-22 |
|
| PDBID: | 9eqr | | Status: | HPUB -- hold until publication | | Title: | 8fs pulse duration 50uJ pulse energy thaumatin | | Authors: | Owen, R.L., Hough, M.A., Worrall, J., Williams, L. | | Deposition date: | 2024-03-22 | | Sequence: | >Entity 1
ATFEIVNRCSYTVWAAASKGDAALDAGGRQLNSGESWTINVEPGTNGGKIWARTDCYFDDSGSGICKTGDCGGLLRCKRFGRPPTTLAEFSLNQYGKDYIDISNIKGFNVPMDFSPTTRGCRGVRCAADIVGQCPAKLKAPGGGCNDACTVFQTSEYCCTTGKCGPTEYSRFFKRLCPDAFSYVLDKPTTVTCPGSSNYRVTFCPTA
|
|
| PDBID: | 8yry | | Status: | HOLD -- hold until a certain date | | Title: | HER3 in complex with FAb Hu3f8 | | Authors: | Wang, M., Li, X. | | Deposition date: | 2024-03-22 | | Release date: | 2025-03-22 |
|
| PDBID: | 8ys5 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the Helicobacter pylori OorDABC complex in the apo-form | | Authors: | Lan, W., Gao, Y., Bi, H. | | Deposition date: | 2024-03-22 |
|
| PDBID: | 8ys6 | | Status: | HPUB -- hold until publication | | Title: | Helicobacter pylori OorDABC in complex with Napabucasin | | Authors: | Lan, W., Gao, Y., Bi, H. | | Deposition date: | 2024-03-22 |
|
| PDBID: | 8ys8 | | Status: | HPUB -- hold until publication | | Title: | The Cyro-EM Structure of human SLC26A3 with non-specific inhibitor Tenidap | | Authors: | Feng, J.R., Dang, S. | | Deposition date: | 2024-03-22 |
|
| PDBID: | 8ys7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of actinomycin D and Echinomycin-d(ACGGGCT/AGCCCCGT) complex | | Authors: | Lee, Y.Y., Hou, M.H. | | Deposition date: | 2024-03-22 |
|
| PDBID: | 8ys4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-22 |
|
| PDBID: | 8ys1 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of rat thioredoxin, Wild-type | | Authors: | Baba, T., Ueno, G., Ohe, C., Saji, S., Yamamoto, S., Yamamoto, M., Ouchida, M., Kawasaki-Ohmori, I., Takeshita, K. | | Deposition date: | 2024-03-22 |
|
| PDBID: | 8yrz | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-03-22 |
|
| PDBID: | 8ys0 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-03-22 |
|
| PDBID: | 8ys3 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of rat thioredoxin, F54L mutant | | Authors: | Takeshita, K., Baba, T., Ohe, C., Saji, S., Yamamoto, S., Yamamoto, M., Ouchida, M., Kawasaki-Ohmori, I. | | Deposition date: | 2024-03-22 |
|
| PDBID: | 8ys2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-22 |
|
| PDBID: | 8ys9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-22 |
|
| PDBID: | 8ysb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-22 |
|
| PDBID: | 8ysc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-22 |
|
| PDBID: | 8ysd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-22 |
|
| PDBID: | 8ysf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-22 |
|
| PDBID: | 8yse | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-22 |
|
| PDBID: | 8ysg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-22 |
|
| PDBID: | 9b52 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-22 |
|
