PDBID: | 9fc3 | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-15 |
|
PDBID: | 9fc4 | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-15 |
|
PDBID: | 9fc5 | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-15 |
|
PDBID: | 9fc6 | Status: | HPUB -- hold until publication | Title: | HEN EGG-WHITE Lysozyme incubated at 87% relative humidity | Authors: | Reinke, P.Y.A., Guenther, S., Falke, S., Galchenkova, M., Rahmani Mashhour, A., Creon, A., Lieske, J., Ewert, W., Rorigues, A.C., Thekku Veedu, S., Fischer, P., Meents, A. | Deposition date: | 2024-05-15 |
|
PDBID: | 9fcc | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-15 |
|
PDBID: | 9fc7 | Status: | HPUB -- hold until publication | Title: | HEN EGG-WHITE Lysozyme incubated at 99% relative humidity | Authors: | Reinke, P.Y.A., Guenther, S., Falke, S., Galchenkova, M., Rahmani Mashhour, A., Creon, A., Lieske, J., Ewert, W., Rorigues, A.C., Thekku Veedu, S., Fischer, P., Meents, A. | Deposition date: | 2024-05-15 |
|
PDBID: | 9fc8 | Status: | HPUB -- hold until publication | Title: | HEN EGG-WHITE Lysozyme incubated at 60% relative humidity | Authors: | Reinke, P.Y.A., Guenther, S., Falke, S., Galchenkova, M., Rahmani Mashhour, A., Creon, A., Lieske, J., Ewert, W., Rorigues, A.C., Thekku Veedu, S., Fischer, P., Meents, A. | Deposition date: | 2024-05-15 |
|
PDBID: | 9fc9 | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-15 |
|
PDBID: | 9fcd | Status: | HPUB -- hold until publication | Title: | CysG(N-16) in complex with SAH from Kitasatospora cystarginea | Authors: | Kuttenlochner, W., Beller, P., Kaysser, L., Groll, M. | Deposition date: | 2024-05-15 | Sequence: | >Entity 1 GSTYDALRRQLIPSFDLLYGSAVSVVAMSVPATARILDLGAGTGLLGAALRERLPDAELLLQDRSQAMLEQARQRFADDDQVAIRVADHLDELPAGPFDAVVSALSIHHLEHQDKQDLFTRIRKILRPGGIFVNVEQVLAPTSELEKMYDRQHEAHVLASDTPAEEWAAGRERMKHDIPIDVETQIQWLRDAGFTTADCLAKDWRFATYAGWNGS
|
|
PDBID: | 9fco | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-15 |
|
PDBID: | 8zjp | Status: | AUTH -- processed, waiting for author review and approval | Title: | Drimenyl diphosphate synthase SsDMS_Y505I&D303A from Streptomyces showdoensis in complex with farnesyl diphosphate (FPP) and Mg2+ | Authors: | Pan, X.M., Dong, S.M., Dong, L.B. | Deposition date: | 2024-05-15 |
|
PDBID: | 8zjz | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-15 |
|
PDBID: | 8zk0 | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-15 |
|
PDBID: | 8zjr | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of nucleosome-bound RFX5 complex | Authors: | Xu, K., Zhang, Y., Yin, Y., Xue, W., Han, Y., Tian, Y. | Deposition date: | 2024-05-15 |
|
PDBID: | 8zjn | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of nucleosome-bound RFX5 complex -asterisk | Authors: | Xu, K., Zhang, Y., Yin, Y., Xue, W., Han, Y., Tian, Y. | Deposition date: | 2024-05-15 |
|
PDBID: | 8zjs | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of hexasome-bound RFX5 complex | Authors: | Xu, K., Zhang, Y., Yin, Y., Xue, W., Han, Y., Tian, Y. | Deposition date: | 2024-05-15 |
|
PDBID: | 8zjo | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of dinucleosome-bound RFX5 complex | Authors: | Xu, K., Zhang, Y., Yin, Y., Xue, W., Han, Y., Tian, Y. | Deposition date: | 2024-05-15 |
|
PDBID: | 8zjq | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of dinucleosome-bound RFX5 complex | Authors: | Xu, K., Zhang, Y., Yin, Y., Xue, W., Han, Y., Tian, Y. | Deposition date: | 2024-05-15 |
|
PDBID: | 8zk4 | Status: | HPUB -- hold until publication | Deposition date: | 2024-05-15 |
|
PDBID: | 8zjh | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryo-EM structure of YF24228-bound porcine bc1 complex | Authors: | Yang, G.-F., Wang, Y.-X., Dong, J.Q. | Deposition date: | 2024-05-15 |
|
PDBID: | 8zjt | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of free nucleosome | Authors: | Xu, K., Zhang, Y., Yin, Y., Xue, W., Han, Y., Tian, Y. | Deposition date: | 2024-05-15 |
|
PDBID: | 8zk7 | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of the Decarboxylase KDC4427 mutant E468L from Enterobacter sp. CGMCC 5087 | Authors: | Dong, S., Liu, L., Zhang, H. | Deposition date: | 2024-05-15 | Release date: | 2025-05-15 |
|
PDBID: | 8zk8 | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of the Decarboxylase KDC4427 mutant E468L in complex with indole-3-pyruvic acid | Authors: | Dong, S., Liu, L., Zhang, H. | Deposition date: | 2024-05-15 | Release date: | 2025-05-15 |
|
PDBID: | 8zk9 | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of the Decarboxylase KDC4427 mutant E468L in complex with phenylpyruvic acid | Authors: | Dong, S., Liu, L., Zhang, H. | Deposition date: | 2024-05-15 | Release date: | 2025-05-15 |
|
PDBID: | 8zka | Status: | HOLD -- hold until a certain date | Title: | Crystal structure of the Decarboxylase KDC4427 in complex with phenylpyruvic acid intermediate | Authors: | Dong, S., Liu, L., Zhang, H. | Deposition date: | 2024-05-15 | Release date: | 2025-05-15 |
|