PDBID: | 8z1j | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-11 |
|
PDBID: | 9bdg | Status: | HPUB -- hold until publication | Title: | Influenza A virus Hemagglutinin H3/Darwin/6/2021 in complex with Fab ADI-85647 | Authors: | Ferreira Ramos, A.S., Bajic, G. | Deposition date: | 2024-04-11 |
|
PDBID: | 9bdf | Status: | HPUB -- hold until publication | Title: | Influenza A virus Hemagglutinin H3/Darwin/6/2021 in complex with Fab ADI-85666 | Authors: | Ferreira Ramos, A.S., Bajic, G. | Deposition date: | 2024-04-11 |
|
PDBID: | 9bd9 | Status: | AUTH -- processed, waiting for author review and approval | Title: | SARS CoV-2 full-length spike protein, 1RBD-up conformation | Authors: | Singh, S., Hasan, S.S. | Deposition date: | 2024-04-11 |
|
PDBID: | 9bd5 | Status: | HPUB -- hold until publication | Title: | Laccase from Bacillus licheniformis | Authors: | Habib, M.H., Smith, T.J. | Deposition date: | 2024-04-11 | Sequence: | >Entity 1 MKLEKFVDKLPIPKVLKPHSKSKEMTYYEVTMKEFQQQLHRDLPPTRLFGYNGVYPGPTFEVQKHEKVAVKWLNKLPDHHFLPVDHTIHDDGHHEHEVKTVVHLHGGRTPPDSDGYPEAWYTKDFQVKGPFFEREVYEYPNEQDATALWYHDHAMAITRLNVYAGLVGLYFIRDREERSLNLPKGEYEIPLLIQDKSFHEDGSLFYPRQPDNPSPDLPDPSIVPAFCGDTILVNGKVWPYDELEPRKYRFRILNASNTRIFELYFDHDITFHQIGTDGGLLQHPVKVNELVIAPAERCDIIVDFSRAEGKTVTLKNRIGCSGQDADPDTDANIMQFRISKPLKQKDTSSLPRILRKRPFYRRHKINTLRNLSLGASLDQYGRPVLLLNNTKWHEPVTETPALGSTEIWSIINAGRAIHPIHLHLVQFLILDHRPFDIERYQENGELVFTGPAAPPAQNEKGLKDTVKVPPGSVTRIIATFAPYSGRYVWHCHILEHEDYDMMRPLEVTDIRHQEFEAWARTKTHLRRGSE
|
|
PDBID: | 9bdb | Status: | HPUB -- hold until publication | Title: | Bacillus anthracis BxpB homotrimer in complex with BclA NTD peptide | Authors: | Schormann, N., Green, T., Turnbough, C.L. | Deposition date: | 2024-04-11 | Sequence: | >Entity 1 MFSSDCEFTKIDCEAKPASTLPAFGFAFNASAPQFASLFTPLLLPSVSPNPNITVPVINDTVSVGDGIRILRAGIYQISYTLTISLDNSPVAPEAGRFFLSLGTPANIIPGSGTAVRSNVIGTGEVDVSSGVILINLNPGDLIRIVPVELIGTVDIRAAALTVAQIS
>Entity 2 AFDPNLVGPTLPPIPPFTL
|
|
PDBID: | 9bda | Status: | HPUB -- hold until publication | Title: | Bacillus anthracis BxpB homotrimer in complex with BclA NTD peptide | Authors: | Schormann, N., Green, T., Turnbough, C.L. | Deposition date: | 2024-04-11 | Sequence: | >Entity 1 MFSSDCEFTKIDCEAKPASTLPAFGFAFNASAPQFASLFTPLLLPSVSPNPNITVPVINDTVSVGDGIRILRAGIYQISYTLTISLDNSPVAPEAGRFFLSLGTPANIIPGSGTAVRSNVIGTGEVDVSSGVILINLNPGDLIRIVPVELIGTVDIRAAALTVAQIS
>Entity 2 AFDPNLVGPTLPPIPPFTL
|
|
PDBID: | 9bd4 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-11 |
|
PDBID: | 9bd8 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-11 |
|
PDBID: | 9bd7 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-11 |
|
PDBID: | 9bd6 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-11 |
|
PDBID: | 9bdh | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-11 |
|
PDBID: | 9bdj | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-11 |
|
PDBID: | 9bdi | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-11 |
|
PDBID: | 9bdd | Status: | HPUB -- hold until publication | Title: | Cryo-EM Structure of Non-Cognate Substrate Bound in the Entry Site (ES) of Human Mitochondrial Transcription Elongation Complex | Authors: | Herbine, K.H., Nayak, A.R., Temiakov, D. | Deposition date: | 2024-04-11 |
|
PDBID: | 9bdc | Status: | HPUB -- hold until publication | Title: | Cryo-EM Structure of the TEFM bound Human Mitochondrial Transcription Elongation Complex in a Closed Fingers Domain Conformation | Authors: | Herbine, K.H., Nayak, A.R., Temiakov, D. | Deposition date: | 2024-04-11 |
|
PDBID: | 9bde | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-11 |
|
PDBID: | 9ez0 | Status: | HPUB -- hold until publication | Title: | Poliovirus type 1 (strain Mahoney) expanded conformation stabilised virus-like particle (PV1 SC6b) from a yeast expression system. | Authors: | Bahar, M.W., Sherry, L., Stonehouse, N.J., Rowlands, D.J., Fry, E.E., Stuart, D.I. | Deposition date: | 2024-04-10 |
|
PDBID: | 9ez4 | Status: | HPUB -- hold until publication | Title: | Complex of a mutant of the SARS-CoV-2 main protease Mpro with the nsp5/6 substrate peptide. | Authors: | Battistutta, R., Fornasier, E., Giachin, G. | Deposition date: | 2024-04-10 |
|
PDBID: | 9ez6 | Status: | HPUB -- hold until publication | Title: | Complex of a mutant of the SARS-CoV-2 main protease Mpro with the nsp14/15 substrate peptide. | Authors: | Battistutta, R., Fornasier, E., Giachin, G. | Deposition date: | 2024-04-10 |
|
PDBID: | 9ez7 | Status: | AUTH -- processed, waiting for author review and approval | Title: | BsmI (Nicking top mutant) crystallized with Ca2+ and cognate dsDNA | Authors: | Sieskind, R., Missoury, S., Madru, C., Commenge, I., Niogret, G., Hollenstein, M., Rondelez, Y., Haouz, A., Legrand, P., Sauguet, L., Delarue, M. | Deposition date: | 2024-04-10 |
|
PDBID: | 9ez3 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of human CLK3 bound to RN129 | Authors: | Kraemer, A., Raig, N., Knapp, S. | Deposition date: | 2024-04-10 |
|
PDBID: | 9eyz | Status: | HOLD -- hold until a certain date | Title: | membrane complex from Haemophilus influenzae - conformation B | Authors: | Castro, D.K.S.V., Delepelaire, P., Biou, V. | Deposition date: | 2024-04-10 | Release date: | 2025-04-10 |
|
PDBID: | 9ez5 | Status: | HPUB -- hold until publication | Title: | BsmI (Inactive) crystallized with Mg2+ and cognate dsDNA | Authors: | Sieskind, R., Missoury, S., Madru, C., Commenge, I., Niogret, G., Rondelez, Y., Haouz, A., Legrand, P., Sauguet, L., Delarue, M. | Deposition date: | 2024-04-10 |
|
PDBID: | 8z0n | Status: | HPUB -- hold until publication | Title: | Structure and dynamics of Drk-SH2 domain and its site-specific interaction with Sev | Authors: | Sayeesh, P.M., Mayumi, I., Inomata, K., IKeya, T., Ito, Y. | Deposition date: | 2024-04-10 |
|