PDBID: | 8yvs | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-29 |
|
PDBID: | 8yvt | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-29 |
|
PDBID: | 8yvu | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-29 |
|
PDBID: | 9b8b | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-29 |
|
PDBID: | 9b8c | Status: | HPUB -- hold until publication | Title: | RM018 Fab in complex with Apex GT 6.2 trimer and RM20A3 Fab | Authors: | Pratap, P.P., Ozorowski, G., Ward, A.B. | Deposition date: | 2024-03-29 |
|
PDBID: | 9b8f | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | SARS CoV-2 full-length spike protein with Lys1269Ala and His1271Ala substitutions in the coatomer binding motif, 2RBD-up conformation | Authors: | Singh, S., Hasan, S.S. | Deposition date: | 2024-03-29 |
|
PDBID: | 9b8g | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-03-29 |
|
PDBID: | 9b87 | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2024-03-29 |
|
PDBID: | 9b86 | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-29 |
|
PDBID: | 9b8a | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2024-03-29 |
|
PDBID: | 9b88 | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-29 |
|
PDBID: | 9b89 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of human ADAR1 in complex with dsRNA derived from HT2C gene in the pre-editing state | Authors: | Deng, X., Gao, Y. | Deposition date: | 2024-03-29 |
|
PDBID: | 9evg | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-29 |
|
PDBID: | 9evf | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-29 |
|
PDBID: | 9evd | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-29 |
|
PDBID: | 9evh | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-03-29 |
|
PDBID: | 9eve | Status: | HPUB -- hold until publication | Title: | Crystal structure of the ARM domain of human ZNFX1 | Authors: | Grabarczyk, D.B., Deszcz, L., Clausen, T. | Deposition date: | 2024-03-29 |
|
PDBID: | 8yvi | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of carboxysomal midi-shell: icosahedral assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T = 13) | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | Deposition date: | 2024-03-28 |
|
PDBID: | 8yve | Status: | HPUB -- hold until publication | Title: | cryo-EM structure of carboxysomal midi-shell: icosahedral assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T = 9) | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | Deposition date: | 2024-03-28 |
|
PDBID: | 8yvf | Status: | HPUB -- hold until publication | Title: | cryo-EM structure of carboxysomal midi-shell: assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T=9 Q=12) | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | Deposition date: | 2024-03-28 | Sequence: | >Entity 1 GIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQ
>Entity 2 MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWN
>Entity 3 RITGPGMLATGLITGTPEFRHAAREELVCAPRSDQMDRVSGEGKERCHITGDDWSVNKHITGTAGQWASGRNPSMRGNARVVETSAFANRNVPKPEKPGSKITGSSGNDTQGSLITYSGGARG
|
|
PDBID: | 8yv7 | Status: | HPUB -- hold until publication | Title: | X-ray structure of Thialysine N-epsilon-acetyltransferase from Caenorhabditis elegans | Authors: | Wang, N., Ma, X. | Deposition date: | 2024-03-28 |
|
PDBID: | 8yv9 | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-03-28 | Release date: | 2025-03-28 |
|
PDBID: | 8yva | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-03-28 | Release date: | 2025-03-28 |
|
PDBID: | 8yvb | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-03-28 | Release date: | 2025-03-28 |
|
PDBID: | 8yvo | Status: | HPUB -- hold until publication | Title: | Crystal structure of the C. difficile toxin A CROPs domain fragment 2639-2707 bound to C4.2 nanobody | Authors: | Sluchanko, N.N., Varfolomeeva, L.A., Shcheblyakov, D.V., Belyi, Y.F., Logunov, D.Y., Gintsburg, A.L., Popov, V.O., Boyko, K.M. | Deposition date: | 2024-03-28 |
|