PDBID: | 8qga | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8qgb | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8qgc | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8qge | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8qgg | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8qgh | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8qgi | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8qgj | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8qgk | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8qgl | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8qgo | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8qgp | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-05 | Release date: | 2025-03-11 |
|
PDBID: | 8qgv | Status: | HPUB -- hold until publication | Title: | Human Carbonic Anhydrase I in complex with 4-(5-acetyl-6-methyl-2-oxo-1,2,3,4-tetrahydropyrimidin-4-yl)benzenesulfonamide | Authors: | Angeli, A., Ferraroni, M. | Deposition date: | 2023-09-05 | Sequence: | >Entity 1 MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
|
|
PDBID: | 8qfv | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-05 |
|
PDBID: | 8qgq | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-05 | Release date: | 2025-03-09 |
|
PDBID: | 8qgm | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8qgn | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8qgd | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-05 | Release date: | 2025-03-11 |
|
PDBID: | 8u25 | Status: | HPUB -- hold until publication | Title: | Crystal Structure of SARS-CoV-2 Main Protease (Mpro) L50F/E166A/L167F Triple Mutant | Authors: | Kohaal, N., Lewandowski, E.M., Wang, J., Chen, Y. | Deposition date: | 2023-09-05 |
|
PDBID: | 8u2a | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-09-05 | Release date: | 2024-09-05 |
|
PDBID: | 8w99 | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-05 | Release date: | 2025-03-05 |
|
PDBID: | 8w9g | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-05 |
|
PDBID: | 8w9i | Status: | HPUB -- hold until publication | Title: | Crystal structure of bacterial prolyl-tRNA synthetase in complex with inhibitor PAA-5 | Authors: | Luo, Z., Zhou, H. | Deposition date: | 2023-09-05 |
|
PDBID: | 8w9u | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-05 |
|
PDBID: | 8w98 | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-05 |
|