PDBID: | 8xb6 | Status: | AUTH -- processed, waiting for author review and approval | Title: | Portal-vertex of SH-Ab15497 in C1 symmetry | Authors: | Lin, J., Zhao, S.W. | Deposition date: | 2023-12-05 |
|
PDBID: | 8xan | Status: | HPUB -- hold until publication | Title: | Major tail protein of SH-Ab15497 | Authors: | Lin, J., Zhao, S.W. | Deposition date: | 2023-12-05 |
|
PDBID: | 8xb1 | Status: | HPUB -- hold until publication | Title: | Crystal structure of FLT3 in complex with a Pyrazinamide Macrocycle derivative | Authors: | Guo, M., Chen, Y. | Deposition date: | 2023-12-05 |
|
PDBID: | 8xao | Status: | HPUB -- hold until publication | Title: | The thermostable and acid-tolerant DNA-binding protein | Authors: | Chen, C.Y., Huang, C.H. | Deposition date: | 2023-12-05 |
|
PDBID: | 8xap | Status: | HPUB -- hold until publication | Title: | Thermostable and acid-tolerant DNA-binding protein | Authors: | Chen, C.Y., Huang, C.H. | Deposition date: | 2023-12-05 |
|
PDBID: | 8xaq | Status: | HPUB -- hold until publication | Title: | The thermostable and acid-tolerant DNA-binding protein | Authors: | Chen, C.Y., Huang, C.H. | Deposition date: | 2023-12-05 |
|
PDBID: | 8xaz | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-05 |
|
PDBID: | 8rbj | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-04 |
|
PDBID: | 8rbk | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-04 |
|
PDBID: | 8rbh | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-04 |
|
PDBID: | 8rba | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-04 |
|
PDBID: | 8rbf | Status: | HPUB -- hold until publication | Title: | CryoEM structure of the post-powerstroke actomyosin-5a complex | Authors: | Klebl, D.P., McMillan, S.N., Risi, C., Forgacs, E., Virok, B., Atherton, J.L., Stofella, M., Winkelmann, D.A., Sobott, F., Galkin, V.E., Knight, P.J., Muench, S.P., Scarff, C.A., White, H.D. | Deposition date: | 2023-12-04 |
|
PDBID: | 8rbb | Status: | HPUB -- hold until publication | Title: | p53-Y220C Core Domain Covalently Bound to 2,5,6-trifluoropyridine-3-carbonitrile Soaked at 40 mM | Authors: | Stahlecker, J., Klett, T., Stehle, T., Boeckler, F.M. | Deposition date: | 2023-12-04 |
|
PDBID: | 8rbg | Status: | HPUB -- hold until publication | Title: | CryoEM structure of primed myosin-5a (ADP-Pi state) | Authors: | Klebl, D.P., McMillan, S.N., Risi, C., Forgacs, E., Virok, B., Atherton, J.L., Stofella, M., Winkelmann, D.A., Sobott, F., Galkin, V.E., Knight, P.J., Muench, S.P., Scarff, C.A., White, H.D. | Deposition date: | 2023-12-04 |
|
PDBID: | 8rbd | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-04 |
|
PDBID: | 8rbl | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-04 |
|
PDBID: | 8rbp | Status: | HPUB -- hold until publication | Title: | Crystal structure of chimeric human carbonic anhydrase IX with 4-chloro-2-(cyclohexylsulfanyl)-N-(2-hydroxyethyl)-5-sulfamoylbenzamide | Authors: | Manakova, E.N., Smirnov, A., Paketuryte, V., Grazulis, S. | Deposition date: | 2023-12-04 | Sequence: | >Entity 1 MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFQVEFDDSQDKAVLKGGPLDGTYRLLQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDVGKALQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLAECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
PDBID: | 8rbc | Status: | HPUB -- hold until publication | Title: | p53-Y220C Core Domain Covalently Bound to 3-amino-5-chloropyrazine-2,6-dicarbonitrile Soaked at 5 mM | Authors: | Stahlecker, J., Klett, T., Stehle, T., Boeckler, F.M. | Deposition date: | 2023-12-04 |
|
PDBID: | 8rbe | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-04 |
|
PDBID: | 8v7p | Status: | HPUB -- hold until publication | Title: | Crystal structure of the truncated P1 pilin from Pseudomonas aeruginosa | Authors: | Bragagnolo, N.J., Audette, G.F. | Deposition date: | 2023-12-04 |
|
PDBID: | 8v7y | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-12-04 |
|
PDBID: | 8v7x | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-04 |
|
PDBID: | 8v6w | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-04 |
|
PDBID: | 8v6x | Status: | HPUB -- hold until publication | Title: | Crystal structure of the core catalytic domain of human inositol phosphate multikinase in complex with compound 2 | Authors: | Wang, H., Shears, S.B. | Deposition date: | 2023-12-04 |
|
PDBID: | 8v75 | Status: | HPUB -- hold until publication | Title: | Crystal structure of the core catalytic domain of human inositol phosphate multikinase in complex with compound 11 | Authors: | Wang, H., Shears, S.B. | Deposition date: | 2023-12-04 |
|