PDBID: | 8vdp | Status: | AUTH -- processed, waiting for author review and approval | Title: | Cryogenic electron microscopy model of full-length talin without FABD | Authors: | Izard, T., Rangarajan, E.S. | Deposition date: | 2023-12-17 |
|
PDBID: | 8vdq | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-12-17 |
|
PDBID: | 8vdr | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-17 |
|
PDBID: | 8xhe | Status: | HPUB -- hold until publication | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | Authors: | Sun, J., Zheng, T.Y. | Deposition date: | 2023-12-17 |
|
PDBID: | 8xhf | Status: | HPUB -- hold until publication | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | Authors: | Sun, J., Zheng, T.Y. | Deposition date: | 2023-12-17 |
|
PDBID: | 8xhg | Status: | HPUB -- hold until publication | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | Authors: | Sun, J., Zheng, T.Y. | Deposition date: | 2023-12-17 |
|
PDBID: | 8xhh | Status: | HPUB -- hold until publication | Title: | Dual receptor-binding, infectivity, and transmissibility of an emerging H2N2 avian influenza virus | Authors: | Sun, J., Zheng, T.Y. | Deposition date: | 2023-12-17 |
|
PDBID: | 8xhj | Status: | HPUB -- hold until publication | Title: | Crystal structure of AtHPPD-HBA complex | Authors: | Dong, J., Lin, H.-Y., Yang, G.-F. | Deposition date: | 2023-12-17 |
|
PDBID: | 8xh8 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-12-17 |
|
PDBID: | 8xh9 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-17 |
|
PDBID: | 8xhi | Status: | AUTH -- processed, waiting for author review and approval | Title: | Toxin BmKaTX15-7A | Authors: | Gu, M.Y. | Deposition date: | 2023-12-17 |
|
PDBID: | 8xh2 | Status: | HPUB -- hold until publication | Title: | Orthorhombic crystal structure of green fluorescent protein nowGFP at pH 6.0 | Authors: | Kim, C.U., Kim, J.K. | Deposition date: | 2023-12-16 |
|
PDBID: | 8vdo | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-12-16 |
|
PDBID: | 8xgz | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-16 |
|
PDBID: | 8xh0 | Status: | HPUB -- hold until publication | Title: | Monoclinic crystal structure of green fluorescent protein nowGFP at pH 4.8 | Authors: | Kim, C.U., Kim, J.K. | Deposition date: | 2023-12-16 |
|
PDBID: | 8xh1 | Status: | HPUB -- hold until publication | Title: | Orthorhombic crystal structure of green fluorescent protein nowGFP at pH 9.0 | Authors: | Kim, C.U., Kim, J.K. | Deposition date: | 2023-12-16 |
|
PDBID: | 8xg4 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8xgf | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8rhm | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 | Sequence: | >Entity 1 GPGSRTPVELRLTEIFRDVLGHDAFGVLDDFFELGGDSFKAIRIAAKYGPPLEVTDIYDHPTIEALAAHLAR
|
|
PDBID: | 8rhb | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2023-12-15 |
|
PDBID: | 8rha | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8rhh | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2023-12-15 |
|
PDBID: | 8rho | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8rhp | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8rhd | Status: | HPUB -- hold until publication | Title: | Crystal structure of Neisseria gonorrhoeae FabI in complex with NADH and (E)-3-((2R,3S)-3-hydroxy-2-methyl-4-oxo-2,3,4,5-tetrahydro-1H-pyrido[2,3-b][1,4]diazepin-8-yl)-N-methyl-N-((3-methylbenzofuran-2-yl)methyl)acrylamide | Authors: | Ronin, C., Gerusz, V., Ciesielski, F. | Deposition date: | 2023-12-15 |
|