PDBID: | 9beb | Status: | HPUB -- hold until publication | Title: | Tungstate binding protein (Tungbindin) from Eubacterium limosum with eight Tungstates bound | Authors: | Zhou, D., Rose, J.P., Chen, L., Wang, B.C. | Deposition date: | 2024-04-15 |
|
PDBID: | 9bea | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | SARS CoV-2 full-length spike protein with internal tag, 2RBD-up conformation | Authors: | Singh, S., Hasan, S.S. | Deposition date: | 2024-04-15 |
|
PDBID: | 9be7 | Status: | HPUB -- hold until publication | Title: | Alkalihalobacillus halodurans (Aha) trp RNA binding attenuation protein (TRAP) mutant dTRAP without Trp | Authors: | Yang, H., Stachowski, K., Foster, M. | Deposition date: | 2024-04-15 | Sequence: | >Entity 1 MNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEGGGGSGGGGSMNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEENLYFQ
|
|
PDBID: | 9be8 | Status: | HPUB -- hold until publication | Title: | Alkalihalobacillus halodurans (Aha) trp RNA binding attenuation protein (TRAP) mutant T49A/T52A dTRAP with Trp | Authors: | Yang, H., Stachowski, K., Foster, M. | Deposition date: | 2024-04-15 | Sequence: | >Entity 1 MNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEGGGGSGGGGSMNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFAEHASAVKIRGKAIIQTSYGTLDTEKDEENLYFQ
|
|
PDBID: | 9bec | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-15 |
|
PDBID: | 9bef | Status: | HPUB -- hold until publication | Title: | Structure of S1_8B, a lambda-carrageenan specific sulfatase, in complex with an oligosaccharide | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | Deposition date: | 2024-04-15 |
|
PDBID: | 9bej | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-15 |
|
PDBID: | 9bek | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-15 |
|
PDBID: | 9be9 | Status: | HPUB -- hold until publication | Title: | HIV-1 Env 16055 dGly4 NFL | Authors: | Ozorowski, G., Lee, W.-H., Ward, A.B. | Deposition date: | 2024-04-15 |
|
PDBID: | 9bed | Status: | HPUB -- hold until publication | Title: | Tungstate binding protein (Tungbindin) from Eubacterium limosum with eight molybdates bound | Authors: | Zhou, D., Rose, J.P., Chen, L., Wang, B.C. | Deposition date: | 2024-04-15 |
|
PDBID: | 9beg | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-15 |
|
PDBID: | 9bel | Status: | HPUB -- hold until publication | Title: | Tungstate binding protein (Tungbindin) from Eubacterium limosum with five Tungstates bound | Authors: | Zhou, D., Rose, J.P., Chen, L., Wang, B.C. | Deposition date: | 2024-04-15 |
|
PDBID: | 9beh | Status: | HPUB -- hold until publication | Title: | Structure of GH110A in complex with galactose-6-sulfate | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | Deposition date: | 2024-04-15 |
|
PDBID: | 9f01 | Status: | HPUB -- hold until publication | Title: | Complex between D-SH2 domain of ABL with nanobody DAM21.3 | Authors: | Essen, L.-O., Hantschel, O., Schmidt, N., Korf, L. | Deposition date: | 2024-04-14 |
|
PDBID: | 9f00 | Status: | HPUB -- hold until publication | Title: | Complex between D-SH2 domain of ABL with monobody DAM27 | Authors: | Essen, L.-O., Hantschel, O., Schmidt, N., Korf, L. | Deposition date: | 2024-04-14 |
|
PDBID: | 9ezq | Status: | HPUB -- hold until publication | Title: | XFEL structure of the free hNQO1 unmixed (P3083) | Authors: | Martin-Garcia, J.M., Grieco, A., Botha, S. | Deposition date: | 2024-04-14 |
|
PDBID: | 9ezr | Status: | HPUB -- hold until publication | Title: | XFEL structure of hNQO1 mixed with NADH for 300 ms (P3083) | Authors: | Martin-Garcia, J.M., Grieco, A., Botha, S. | Deposition date: | 2024-04-14 |
|
PDBID: | 9ezs | Status: | HPUB -- hold until publication | Title: | XFEL structure of free hNQO1 unmixed (P4502) | Authors: | Martin-Garcia, J.M., Grieco, A., Botha, S. | Deposition date: | 2024-04-14 |
|
PDBID: | 9ezt | Status: | HPUB -- hold until publication | Title: | XFEL structure of hNQO1 mixed with NADH for 1190ms (P4502) | Authors: | Martin-Garcia, J.M., Grieco, A., Botha, S. | Deposition date: | 2024-04-14 |
|
PDBID: | 9ezu | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-14 |
|
PDBID: | 9ezy | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-14 |
|
PDBID: | 9ezv | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-14 |
|
PDBID: | 9ezw | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-14 |
|
PDBID: | 8z2z | Status: | HPUB -- hold until publication | Title: | PRMT1-Tetramer | Authors: | Nadendla, E.K., Wang, C.H., Ho, M.C. | Deposition date: | 2024-04-14 |
|
PDBID: | 8z31 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-04-14 |
|