| PDBID: | 9ne0 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9ne4 | | Status: | HPUB -- hold until publication | | Title: | cryoEM structure of the A-chain of the human OGA-L Catalytic Dimer | | Authors: | Nyenhuis, S.B., Steenackers, A., Hinshaw, J.E., Hanover, J.A. | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9ne5 | | Status: | HPUB -- hold until publication | | Title: | cryoEM structure of the B-chain of the human OGA-L Catalytic Dimer | | Authors: | Nyenhuis, S.B., Steenackers, A., Hinshaw, J.E., Hanover, J.A. | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9nec | | Status: | HPUB -- hold until publication | | Title: | AcA-EI-shaker with free peptide conformation A | | Authors: | Tan, X., Swartz, K.J. | | Deposition date: | 2025-02-19 |
|
| PDBID: | 9lxf | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-18 | | Release date: | 2026-02-18 |
|
| PDBID: | 9lxd | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-18 | | Release date: | 2026-02-18 |
|
| PDBID: | 9lxk | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-02-18 | | Release date: | 2026-02-18 |
|
| PDBID: | 9lxh | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9lxi | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-18 | | Sequence: | >Entity 1
MAQTVGVIGTGLMGSALVNTLLKAGTKVTVWDGRKEATAGVVANGAKLASSFVELVNGNDVVISIVSSASIGANLFREHVSQLNLDGRYVANLSTAMPEDGEAFRDIIESNGGRFISAAISSYPDLIGGPYTAIQYAGKEEVWRAVEATFKPLAPEGTIYTGANLAVPPIVDAAMTGSFYAVSLAGFLEAAAYAKARGVSPSQLGDFADKMLDLVRYKVHKSIREIEANNFETIQATVDVYLDAVIQWRDALKDVGLRASHIAALADDLTVTRDAGYGSLGFTAQFLTASKVD
|
|
| PDBID: | 9lxj | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-18 | | Release date: | 2026-02-18 |
|
| PDBID: | 9lxm | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9lxe | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-18 | | Release date: | 2026-02-18 |
|
| PDBID: | 9ndc | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | [5,7,8-1] Shifted tensegrity triangle with an (arm,center,arm) distribution of (5,7,8) base pairs and 1 nt sticky ends | | Authors: | Horvath, A., Vecchioni, S., Woloszyn, K., Ohayon, Y.P., Sha, R. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ndd | | Status: | HPUB -- hold until publication | | Title: | RNA scaffold attached to 8-oxoguanine riboswitch aptamer, combined core plus aptamer | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ndr | | Status: | HPUB -- hold until publication | | Title: | The 1.22 Angstrom crystal structure of galactose oxidase variant with genetically incorporated F2-Tyr495 | | Authors: | Liu, A., Li, J., Graciano, A. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ndu | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of Ferric Human ADO C18S/C239S Variant in Complex with Hydralazine at 1.98 Angstrom Resolution | | Authors: | Liu, A., Li, J., Duan, R. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ndm | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ndy | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ndj | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the endogenous ClpP1/ClpP2 heterocomplex from Pseudomonas aeruginosa bound to the AAA+ ClpX unfoldase. | | Authors: | Ghanbarpour, A., Zhang, J.J., Baker, T.A., Davis, J.H., Sauer, R.T. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ndh | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | [4,8,8,P-1] Shifted tensegrity triangle with an (arm,center,arm) distribution of (4,8,8) base pairs, 1 nt sticky ends, and 5'' phosphates | | Authors: | Horvath, A., Vecchioni, S., Woloszyn, K., Ohayon, Y.P., Sha, R. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ndp | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9nds | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ndv | | Status: | HPUB -- hold until publication | | Title: | Scaffold attached to quinine-I aptamer (Tonic) local refinement of aptamer | | Authors: | Jones, C.P., Ferre-D''Amare, A.R. | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ndq | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-18 |
|
| PDBID: | 9ndl | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-18 |
|
