| PDBID: | 9rd1 | | Status: | HPUB -- hold until publication | | Title: | OppA from E. coli in complex with GSisoK | | Authors: | Iype, T., Fottner, M., Boehm, P., Piedrafita, C., Moeller, Y., Groll, M., Lang, K. | | Deposition date: | 2025-05-30 | | Sequence: | >Entity 1
ADVPAGVTLAEKQTLVRNNGSEVQSLDPHKIEGVPESNISRDLFEGLLVSDLDGHPAPGVAESWDNKDAKVWTFHLRKDAKWSDGTPVTAQDFVYSWQRSVDPNTASPYASYLQYGHIAGIDEILEGKKPITDLGVKAIDDHTLEVTLSEPVPYFYKLLVHPSTSPVPKAAIEKFGEKWTQPGNIVTNGAYTLKDWVVNERIVLERSPTYWNNAKTVINQVTYLPIASEVTDVNRYRSGEIDMTNNSMPIELFQKLKKEIPDEVHVDPYLCTYYYEINNQKPPFNDVRVRTALKLGMDRDIIVNKVKAQGNMPAYGYTPPYTDGAKLTQPEWFGWSQEKRNEEAKKLLAEAGYTADKPLTINLLYNTSDLHKKLAIAASSLWKKNIGVNVKLVNQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSNSSMNTAHYKSPAFDSIMAETLKVTDEAQRTALYTKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNTYTRNMYIVKHHHHHH
|
|
| PDBID: | 9v87 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9v88 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9v89 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9v81 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-05-29 | | Release date: | 2026-05-29 |
|
| PDBID: | 9v82 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-05-29 | | Release date: | 2026-05-29 |
|
| PDBID: | 9v8i | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9v8l | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9v83 | | Status: | HOLD -- hold until a certain date | | Title: | Crystal Structure of Asparagine Synthetase from Entamoeba histolytica | | Authors: | Mishra, S., Yadav, L., Gautam, A.K., Gourinath, S. | | Deposition date: | 2025-05-29 | | Release date: | 2026-05-29 |
|
| PDBID: | 9v8a | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9v84 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of complex Hit-1 with YTHDC1 | | Authors: | Zhang, H., Yang, S.Y. | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9v8b | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Influenza A(H5N6) virus polymerase in initiation state with bound vRNA promoter | | Authors: | Wang, A.J., Liao, M. | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9v8e | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9v8c | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The mML/CoV RBD with 4 mutations in complex with hACE2 bound to Ab64 Fab | | Authors: | Chen, Y., Liu, P. | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9v8f | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9v8j | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Influenza A(H5N6) virus polymerase in intermediate state with bound vRNA promoter | | Authors: | Wang, A.J., Liao, M. | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9v8t | | Status: | HPUB -- hold until publication | | Title: | Fibril structure of SOD1 mutant H46D | | Authors: | Wang, L.Q., Zhang, M.Y., Ma, Y.Y., Yuan, H.Y., Xia, W.C., Li, X.N., Zhao, K., Chen, J., Li, D., Liu, C., Liang, Y. | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9v8g | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9v8h | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9v8k | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Influenza A(H5N6)virus polymerase in pre-initiation state with bound vRNA promoter | | Authors: | Wang, A.J., Liao, M. | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9v8s | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human glutaminyl-peptide cyclotransferase with I321A mutation, in complex with (E)-3-phenyl-6-((5-(prop-1-en-1-yl)-1H-imidazol-1-yl)methyl)pyridin-2(1H)-one | | Authors: | Li, G.B., Ning, X.-L. | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9v8r | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Crystal structure of human glutaminyl-peptide cyclotransferase with I321A mutation, in complex with 3-phenyl-6-((5-propyl-1H-imidazol-1-yl)methyl)pyridin-2(1H)-one | | Authors: | Li, G.B., Ning, X.-L. | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9v8q | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human glutaminyl-peptide cyclotransferase with I321V mutation, in complex with (E)-3-phenyl-6-((5-(prop-1-en-1-yl)-1H-imidazol-1-yl)methyl)pyridin-2(1H)-one | | Authors: | Li, G.B., Ning, X.-L. | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9v8p | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Crystal structure of human glutaminyl-peptide cyclotransferase with I321V mutation, in complex with 3-phenyl-6-((5-propyl-1H-imidazol-1-yl)methyl)pyridin-2(1H)-one | | Authors: | Li, G.B., Ning, X.-L. | | Deposition date: | 2025-05-29 |
|
| PDBID: | 9v8o | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Influenza A(H5N6) virus polymerase symmetric dimer in post-termination state with bound vRNA promoter | | Authors: | Wang, A.J., Liao, M. | | Deposition date: | 2025-05-29 |
|
