| PDBID: | 9o6g | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-13 |
|
| PDBID: | 9o6f | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of SARS-CoV-2 Mpro S113A in complex with Pfizer Intravenous Inhibitor PF-00835231 | | Authors: | Zvornicanin, S.N., Shaqra, A.M., Schiffer, C.A. | | Deposition date: | 2025-04-13 |
|
| PDBID: | 9qvx | | Status: | HPUB -- hold until publication | | Title: | The targeting of non-fibrillar polyQ via distinct VCP-proteasome coupling | | Authors: | Zhao, D.Y., Mi, C.C. | | Deposition date: | 2025-04-13 |
|
| PDBID: | 9qvy | | Status: | HPUB -- hold until publication | | Title: | Nostoc sp. 3335mg GT108 family enzyme complex with mannose-1-phosphate (M1P) | | Authors: | Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J. | | Deposition date: | 2025-04-13 |
|
| PDBID: | 9qvz | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-13 |
|
| PDBID: | 9qw0 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Nostoc sp. 3335mg GT108 family enzyme D90A mutant complex with octyl-mannotetraose and Bis-Tris | | Authors: | Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J. | | Deposition date: | 2025-04-13 |
|
| PDBID: | 9qw1 | | Status: | HPUB -- hold until publication | | Title: | Nostoc sp. 3335mg GT108 family enzyme D90A mutant complex with octyl-mannotetraose | | Authors: | Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J. | | Deposition date: | 2025-04-13 |
|
| PDBID: | 9ugn | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-12 |
|
| PDBID: | 9ugm | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-12 | | Release date: | 2026-04-12 |
|
| PDBID: | 9ugh | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | crystal structure of ferritin from pig spleen | | Authors: | Tuo, Z., Meng, C. | | Deposition date: | 2025-04-12 |
|
| PDBID: | 9ugj | | Status: | HPUB -- hold until publication | | Title: | Structure of SARM1 bound to SIR3-ADPR | | Authors: | Zhang, J., Zheng, S., Wang, X. | | Deposition date: | 2025-04-12 |
|
| PDBID: | 9ugk | | Status: | HOLD -- hold until a certain date | | Title: | Crystal Structure of Rv0866 from Mycobacterium tuberculosis | | Authors: | Cho, H.J., Kang, B.S. | | Deposition date: | 2025-04-12 | | Release date: | 2026-04-12 |
|
| PDBID: | 9ugl | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-12 |
|
| PDBID: | 9o6c | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | X-ray structure of a bivalent diabody of 8B6, a murine monoclonal antibody specific for the human serotonin transporter | | Authors: | Coleman, J.A., Gouaux, E. | | Deposition date: | 2025-04-12 |
|
| PDBID: | 9o6d | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal Structure of SARS-CoV-2 Mpro S10A in complex with Pfizer Intravenous Inhibitor PF-00835231 | | Authors: | Zvornicanin, S.N., Shaqra, A.M., Schiffer, C.A. | | Deposition date: | 2025-04-12 |
|
| PDBID: | 9qvu | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human lung surfactant protein D trimeric fragment with bound synthetic HepI-(1,5)-KdoI ligand | | Authors: | Shrive, A.K., Greenhough, T.J., Williams, H.M. | | Deposition date: | 2025-04-12 | | Sequence: | >Entity 1
GSPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEF
|
|
| PDBID: | 9qvv | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-12 |
|
| PDBID: | 9qvw | | Status: | HPUB -- hold until publication | | Title: | Nostoc sp. 3335mg GT108 family enzyme native | | Authors: | Males, A., Ralton, J.E., Kaur, A., Butriss, K., Sobala, L.F., Sharma, M., Moroz, O.V., Williams, S.J., McConville, M.J., Davies, G.J. | | Deposition date: | 2025-04-12 |
|
| PDBID: | 9uga | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-11 | | Release date: | 2026-04-11 |
|
| PDBID: | 9ug9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-11 |
|
| PDBID: | 9ugg | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | PsdAB dimer | | Authors: | He, Y.T., Fan, W.J., Shao, K., Luo, M. | | Deposition date: | 2025-04-11 |
|
| PDBID: | 9ug4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-11 |
|
| PDBID: | 9ug2 | | Status: | HPUB -- hold until publication | | Title: | Severed and capped actin fragment by two G1G3 domains of gelsolin | | Authors: | Kim, H., Jung, H.S. | | Deposition date: | 2025-04-11 |
|
| PDBID: | 9ug3 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-11 |
|
| PDBID: | 9ug5 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HA3 from Clostridium botulinum type B with alpha2,3-sialyllactose | | Authors: | Amatsu, S., Kitadokoro, K. | | Deposition date: | 2025-04-11 | | Sequence: | >Entity 1
MASWSHPQFEKGALEVLFQGPGYQYSDTIDLADGNYVVSRGDGWILSRQNQILGGSVISNGSTGIVGDLRVNDNAIPYYYPTPSFNEEYIKNNIQTVFANFTEANQIPIGFEFSKTAPSNKNLYMYLQYTYIRYEIIKVLQHEIIERAVLYVPSLGYVKSIEFNPGEKINKDFYFLTNDKCILNEQFLYKKILETTKNIPTNNIFNSKVSSTQRVLPYSNGLYVINKGDGYIRTNDKDLIGTLLIEAGSSGSIIQPRLRNTTRPLFTTSNDAKFSQQYTEERLKDAFNVQLFNTSTSLFKFVEEAPSNKNICIKAYNTYEKYELIDYQNGSIVNKAEYYLPSLGYCEVTNAPSPESEVVKTQVAEDGFIQNGPEEEIVVGVIDPSENIQEINTAISDNYTYNIPGIVNNNPFYILFTVNTTGIYKINAQNNLPSLKIYEAIGSGNRNFQSGNLCDDDIKAINYITGFDSPNAKSYLVVLLNKDKNYYIRVPQTSSNIENQIKFKREEGDLRNLMNSSVNIIDNLNSTGAHYYTRQSPDVHDYISYEFTIPGNFNNKDTSNIRLYTSYNQGIGTLFRVTETIDGYNLINIQQNLNLLNSTKSIRLLNGAIYILKVEVTELNNYNIKLHIDITN
|
|
